DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and si:dkey-21e2.10

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_009294620.1 Gene:si:dkey-21e2.10 / 556860 ZFINID:ZDB-GENE-050208-778 Length:249 Species:Danio rerio


Alignment Length:250 Identity:71/250 - (28%)
Similarity:110/250 - (44%) Gaps:43/250 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 PH---AARLGHKDENG----------EVEWF----CGGTLISDRHVLTAAHCHYSPQGSVNIARL 132
            ||   .||:|.:|...          .::::    |||:||::..|||||||.........:...
Zfish    14 PHLTFTARVGIQDGTEAKPHSRPYMVSLQFYKLHMCGGSLITEEFVLTAAHCWEEDDVLTVVTGA 78

  Fly   133 GDLEFDTNNDDADPEDFDVKDFTAHPEFSYPAIYNDISVVRLSRPVTFNDYKHPACLPFD--DGR 195
            .||.....|:     .:.||.:..||:|:...:.|||.:::|...|..::......||.|  |.:
Zfish    79 HDLRKKAINN-----VYKVKSYIPHPDFNSKTLENDIMLLQLKTKVRLSNNVGLISLPKDGEDVK 138

  Fly   196 LGTSFIAIGWGQL-EIVPRTENKKLQKVKLYNYGTRCRITADRNDELPEGYNATTQLCIGSNEHK 259
            ..|.....|||.| ...|.|:..:..:..:.|       .|:........|.|:..:|:..  |.
Zfish   139 ADTLCSVAGWGDLWSKGPETDRLREAETVIVN-------NAECERRWESDYVASKMICVYG--HG 194

  Fly   260 DTCNGDSGGPVLIYHMDYPCMYHVMGITSIG--VACDTPDLPAMYTRVHFYLDWI 312
            .||:||||||::       |...|:||||.|  ..|::...|.::||:..||.||
Zfish   195 GTCSGDSGGPLV-------CGDTVVGITSFGEPYLCNSRLFPDVHTRISAYLPWI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 70/249 (28%)
Tryp_SPc 73..312 CDD:214473 69/248 (28%)
si:dkey-21e2.10XP_009294620.1 Tryp_SPc 27..242 CDD:214473 63/235 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.