DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and Jon99Fi

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster


Alignment Length:263 Identity:68/263 - (25%)
Similarity:109/263 - (41%) Gaps:62/263 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 IIGGGPAVPKEFPHAARLGHKDENGEVEWFCGGTLISDRHVLTAAHCHYSPQG-SVNIARLGDLE 136
            |..|.||...:.|:...|..   :|...|:|||::|.:..|||||||.....| ::|...     
  Fly    38 ITNGYPAYEGKVPYIVGLLF---SGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTINYGA----- 94

  Fly   137 FDTNNDDADPEDFDVKDFTAHPEFSYPAIYNDISVVRLSRPVTFNDYKHPACLPFDDGR----LG 197
             ...|...........:|..|..::...::||||::|... |.|....:...||..:.|    .|
  Fly    95 -SLRNQPQYTHWVGSGNFVQHHHYNSGNLHNDISLIRTPH-VDFWHLVNKVELPSYNDRYQDYAG 157

  Fly   198 TSFIAIGWG---------------QLEIVPRTENKKLQKVKLYNYGTRCRITADRNDELPEGYNA 247
            ...:|.|||               .::|:.:::               |..|...:|.:      
  Fly   158 WWAVASGWGGTYDGSPLPDWLQAVDVQIMSQSD---------------CSRTWSLHDNM------ 201

  Fly   248 TTQLCIGSNEHKDTCNGDSGGPVLIYHMDYPCMYHVMGITSI--GVACDTPDLPAMYTRVHFYLD 310
               :||.:|..|.||.||||||::.:..:     .::|:||.  ...|.: ..||:::||..|||
  Fly   202 ---ICINTNGGKSTCGGDSGGPLVTHEGN-----RLVGVTSFVSSAGCQS-GAPAVFSRVTGYLD 257

  Fly   311 WIK 313
            ||:
  Fly   258 WIR 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 68/263 (26%)
Tryp_SPc 73..312 CDD:214473 66/260 (25%)
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 66/260 (25%)
Tryp_SPc 38..262 CDD:238113 68/263 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437128
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.