DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and Jon99Ci

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster


Alignment Length:269 Identity:73/269 - (27%)
Similarity:118/269 - (43%) Gaps:68/269 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 IIGGGPAVPKEFPHAARLGHKDENGEVEWFCGGTLISDRHVLTAAHC---------HYSPQGSVN 128
            |..|..|...:.|:...:. .:.||. .|:|||::|....|||||||         :|   |:||
  Fly    41 ITNGNLASEGQVPYIVGVS-LNSNGN-WWWCGGSIIGHTWVLTAAHCTAGADEASLYY---GAVN 100

  Fly   129 IARLGDLEFDTNNDDADPEDFDVKDFTAHPEFSYPAIYNDISVVRLSRPVTFNDYKHPACLPFDD 193
            .           |:.|.......::|..:|.  |..:.:|:::::... |.|....:...||..|
  Fly   101 Y-----------NEPAFRHTVSSENFIRYPH--YVGLDHDLALIKTPH-VDFYSLVNKIELPSLD 151

  Fly   194 GRLGT---SFI-AIGWGQL----EIVPRTENKKLQKVKLYN-------YGTRCRITADRNDELPE 243
            .|..:   ::: |.|||.:    .:|   |:.::..:|:.:       |||.   ||..|     
  Fly   152 DRYNSYENNWVQAAGWGAIYDGSNVV---EDLRVVDLKVISVAECQAYYGTD---TASEN----- 205

  Fly   244 GYNATTQLCIGSNEHKDTCNGDSGGPVLIYHMDYPCMYHVMGITSI--GVACDTPDLPAMYTRVH 306
                  .:|:.:.:.|.||.||||||::....|     .::||||.  ...|.... ||.:|||.
  Fly   206 ------TICVETPDGKATCQGDSGGPLVTKEGD-----KLIGITSFVSAYGCQVGG-PAGFTRVT 258

  Fly   307 FYLDWIKQQ 315
            .||:|||::
  Fly   259 KYLEWIKEE 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 73/267 (27%)
Tryp_SPc 73..312 CDD:214473 70/264 (27%)
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 70/264 (27%)
Tryp_SPc 41..266 CDD:238113 72/266 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437143
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.030

Return to query results.
Submit another query.