DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and CG11841

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:312 Identity:182/312 - (58%)
Similarity:220/312 - (70%) Gaps:6/312 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LGAVLLVSFVAWAS---AQDSD--IARTCTAYKRSVWEETSEFSFLIENAPIIYKTLDKCTSYAP 71
            |..:||:.|...:|   .|:.|  ....||.:|:.|:||....||...:|||.|:|:|.|....|
  Fly     6 LELILLLVFSLSSSLVQGQNPDPFAQLACTKFKQIVFEERVAISFFFTDAPITYETVDSCHGSRP 70

  Fly    72 LIIGGGPAVPKEFPHAARLGHKDENGEVEWFCGGTLISDRHVLTAAHCHYSPQGSVNIARLGDLE 136
            ||:.|.||.|||||.||||||:..|.|::|||||||||:|.|||||||.:|..|.||:.|||:||
  Fly    71 LIVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNVVRLGELE 135

  Fly   137 FDTNNDDADPEDFDVKDFTAHPEFSYPAIYNDISVVRLSRPVTFNDYKHPACLPFDDGRLGTSFI 201
            |||:.|||:||||.|....|||.|..|.:||||.:|:|.|.|.||.||||||||||||....|||
  Fly   136 FDTDTDDAEPEDFGVLALKAHPGFENPQLYNDIGIVQLDREVKFNRYKHPACLPFDDGEQHESFI 200

  Fly   202 AIGWGQLEIVPRTENKKLQKVKLYNYGTRCRITADRNDELPEGYNATTQLCIGSNEHKDTCNGDS 266
            ||||||.:...: |:|||.||:|..|..||..:.|.|||||.||...:||||||.::||||||||
  Fly   201 AIGWGQKKFAQK-ESKKLLKVQLQGYKDRCVSSVDANDELPNGYEPKSQLCIGSRDNKDTCNGDS 264

  Fly   267 GGPVLIYHMDYPCMYHVMGITSIGVACDTPDLPAMYTRVHFYLDWIKQQLAK 318
            |||||.||.|..||||||||||.|:.|.|||:|:.|||||::|:|||.:|||
  Fly   265 GGPVLAYHKDLACMYHVMGITSAGITCSTPDIPSAYTRVHYFLNWIKGELAK 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 155/241 (64%)
Tryp_SPc 73..312 CDD:214473 152/238 (64%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 153/239 (64%)
Tryp_SPc 72..310 CDD:214473 152/238 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468439
Domainoid 1 1.000 204 1.000 Domainoid score I6255
eggNOG 1 0.900 - - E33208_3BPQ8
Homologene 1 1.000 - - H116049
Inparanoid 1 1.050 214 1.000 Inparanoid score I6028
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25874
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 1 1.000 - - FOG0012717
OrthoInspector 1 1.000 - - otm49624
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
1211.910

Return to query results.
Submit another query.