DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and CG4815

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:228 Identity:56/228 - (24%)
Similarity:94/228 - (41%) Gaps:42/228 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 CGGTLISDRHVLTAAHCHYSPQGS---VNIARLGDLEFDTNNDDADPEDFDVKDFTAHPEFSYPA 164
            |..||::.||:||||||..:...|   |...:..:..:..||.:.:    .:.....||:::...
  Fly    61 CSATLLTPRHILTAAHCFENLNRSKFHVIGGKSAEFTWHGNNFNKN----KLIRVQIHPKYAKMK 121

  Fly   165 IYNDISVVRLSRPV--TFNDYK-------HPACLPFDDGRLGTSFIAIGWG-QLEIVPRTENKKL 219
            ...|::|.:...|:  .:..|.       ||.          ...||.||| :..:...:..|..
  Fly   122 FIADVAVAKTKYPLRSKYIGYAQLCRSVLHPR----------DKLIAAGWGFEGGVWDESRKKTF 176

  Fly   220 QKVKLYNYGTR-CRITADRNDELPEGYNATTQLCIGSNEHKDTCNGDSGGPVLIYHMDYPCMYHV 283
            :.:|:.....| |....||  ::|...     :|.|:..:|..|.||||||:|:..       .|
  Fly   177 RSMKVGIVSKRDCEKQLDR--KMPPNI-----ICAGAYNNKTLCFGDSGGPLLLGR-------QV 227

  Fly   284 MGITSIGVACDTPDLPAMYTRVHFYLDWIKQQL 316
            .||.:....|...:.|.:|..|.:|..:||:.:
  Fly   228 CGINTWTFKCGNNEKPDVYMGVRYYAKFIKRTI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 56/225 (25%)
Tryp_SPc 73..312 CDD:214473 54/222 (24%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 56/225 (25%)
Trypsin 49..256 CDD:278516 54/222 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437188
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.