DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and CG10232

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster


Alignment Length:278 Identity:84/278 - (30%)
Similarity:128/278 - (46%) Gaps:45/278 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 CTSYAPL--IIGGGPAVPKEFPHAARLGHKDENGEVEWF---CGGTLISDRHVLTAAHCHYSPQG 125
            |....||  :..|..|.|.|:|..|.|.:  ||..:...   |.|:||:.|:|||||||....: 
  Fly   248 CGQAPPLYRMAYGTAARPNEYPWMAMLIY--ENRRLSTMTNNCSGSLINKRYVLTAAHCVVKDK- 309

  Fly   126 SVNI------ARLGDLEFDTNND-------DADPEDFDVKDFTAHPE-FSYPAIYNDISVVRLSR 176
            .||.      .|||:.:..||.|       .|...:..::.|..|.: |:.....:||::|||..
  Fly   310 MVNTDLVLRRVRLGEHDITTNPDCDFTGNCAAPFVEIGIEYFNVHEQYFNTSRFESDIALVRLQT 374

  Fly   177 PVTFNDYKHPACLPFDDGRLGTSFIAI-GWGQLEIVPRTENKKLQKVKLYN------YGTRCRIT 234
            ||.:.....|.|:|.|...|....:.| |||.      |:|::..:|.|:|      |..:.:|:
  Fly   375 PVRYTHEILPICVPKDPIPLHNHPLQIAGWGY------TKNREYSQVLLHNTVYENRYYCQDKIS 433

  Fly   235 ADRNDELPEGYNATTQLCIGSNEHKDTCNGDSGGPVLI-YHMDYPCMYHVMGITSIGVACDTPDL 298
            ..||:         :|:|......:|:|.||||||::: .:.||..:.::.||.|.|........
  Fly   434 FFRNE---------SQICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGIVSYGSENCGDRK 489

  Fly   299 PAMYTRVHFYLDWIKQQL 316
            |.:||:...:..|||..|
  Fly   490 PGVYTKTGAFFSWIKANL 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 80/266 (30%)
Tryp_SPc 73..312 CDD:214473 77/263 (29%)
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 80/263 (30%)
Tryp_SPc 260..503 CDD:214473 77/260 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437539
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.