DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and SPE

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster


Alignment Length:293 Identity:94/293 - (32%)
Similarity:137/293 - (46%) Gaps:70/293 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 YAPLIIGGGPAVPKEFPHAARLGHKDENGEVEWF-CGGTLISDRHVLTAAHCHYSPQ----GSV- 127
            :|..|.||......|||....|.:|....|...| |||.|::.|:||||.||..|.:    |:| 
  Fly   131 FADRIFGGTNTTLWEFPWMVLLQYKKLFSETYTFNCGGALLNSRYVLTAGHCLASRELDKSGAVL 195

  Fly   128 NIARLGDLEFDTNND-DADPE------------DFDVKDFTAHPEFSYPAI--YNDISVVRLSRP 177
            :..|||  |:||..| |...:            |.:|:....|..::..::  .|||::|||.|.
  Fly   196 HSVRLG--EWDTRTDPDCTTQMNGQRICAPKHIDIEVEKGIIHEMYAPNSVDQRNDIALVRLKRI 258

  Fly   178 VTFNDYKHPACLPFDDGRLGTSFI-----AIGWGQLEIVPRTENKKLQKVKL------YNYGTRC 231
            |::.||..|.||| .||.:..:|:     ..|||      .|||.:...:||      :|. |.|
  Fly   259 VSYTDYVRPICLP-TDGLVQNNFVDYGMDVAGWG------LTENMQPSAIKLKITVNVWNL-TSC 315

  Fly   232 RITADRNDELPEGYNA------TTQLCIGSNEHKDTCNGDSGGPVLIYHMDYPC------MYHVM 284
            :          |.|::      .:|:|.|.....|||.||||||:::     |.      ::::.
  Fly   316 Q----------EKYSSFKVKLDDSQMCAGGQLGVDTCGGDSGGPLMV-----PISTGGRDVFYIA 365

  Fly   285 GITSIGV-ACDTPDLPAMYTRVHFYLDWIKQQL 316
            |:||.|. .|.....|.:|||...::|||||:|
  Fly   366 GVTSYGTKPCGLKGWPGVYTRTGAFIDWIKQKL 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 91/286 (32%)
Tryp_SPc 73..312 CDD:214473 88/283 (31%)
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 91/286 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437560
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.