DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and CG31199

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:289 Identity:60/289 - (20%)
Similarity:103/289 - (35%) Gaps:102/289 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 AVPKEFPHAARL-------GHKDENGEVEWFCGGTLISDRHVLTAAHCHYSPQG-----SVNI-- 129
            |:|.|....||:       |...:||     |.|.|:|.|.||..|||.....|     ||::  
  Fly    45 AIPTEHQWVARIVYGKGFEGKIRDNG-----CLGVLVSKRTVLAPAHCFVQYNGVAEAFSVHLGV 104

  Fly   130 ----ARLGDLEFDTNNDDADP-EDFDVKDFTAHPEFSYPAIYNDISVVRLSRPVTFNDYKHPACL 189
                |.:|....:|:.....| ::..:.:...||::....:.|.::|:.|.|.........|.|:
  Fly   105 HNKSAPVGVRVCETDGYCVRPSQEIKLAEIAIHPDYDSRTLKNSLAVLTLQRDAKIYPNVMPICM 169

  Fly   190 P---------------------FDDGRLGT--SFIAIGWGQLEIVPRTENKKLQKVKLYNYGTRC 231
            |                     |:|.||.|  :.::.|:.|.::          |..:.:..|.|
  Fly   170 PPPSLLNETLVAQTFVVAGLRVFEDFRLKTWVNTLSRGFCQSKV----------KTLVTSSNTVC 224

  Fly   232 RITADRNDELPEGYNATTQLCIGSNEHKDTCNGDSGGPVLIYHMDYPCM-----------YHVMG 285
                        ||            ||.        || .|::..|.:           |:::|
  Fly   225 ------------GY------------HKQ--------PV-AYYLGAPLVGLQKKGHVTQNYYLVG 256

  Fly   286 ITSIGVACDTPDLPAMYTRVHFYLDWIKQ 314
            | .|....:...:.:.:..:..|:|:|:|
  Fly   257 I-MIDWRWENNRIMSSFLAIRNYMDFIRQ 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 60/289 (21%)
Tryp_SPc 73..312 CDD:214473 58/285 (20%)
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:304450 53/259 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.