DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and CG31219

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:275 Identity:87/275 - (31%)
Similarity:131/275 - (47%) Gaps:51/275 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 IIGGGPAVPKEFPHAARLGHKDENG-EVEWFCGGTLISDRHVLTAAHC-HYSPQG-SVNIARLG- 133
            ::||..|.|..:|..|.|.:.:... |:..||.|:||::|:|||:||| :..|:. |:...||| 
  Fly    89 MVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHCVNGIPRDLSLKSVRLGE 153

  Fly   134 -DLEFDT--NNDDADPE--------DFDVKDFTAHPEFSYPAIYN-----DISVVRLSRPVTFND 182
             |:.:|.  |.|..|.:        :..::....|..||  :|.|     ||:::||..||.:..
  Fly   154 HDITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLFS--SISNRNIEYDIALLRLKMPVRYRT 216

  Fly   183 YKHPACLPFDDGRLGTSFIAI-GWGQLEIVPRTENKKLQKVKLYNYGTRCRITA---------DR 237
            ...|.|:| ..|....|.:.| |||      :|...:..:|.::.: .|.|..|         |.
  Fly   217 GIMPICIP-KHGFFAKSKLEIAGWG------KTNEGQFSQVLMHGF-IRERSIAVCALRFPYLDL 273

  Fly   238 NDELPEGYNATTQLCIGSNEHKDTCNGDSGGPVLIYHMDYPCMYHVMGITSIGVA-CDTPDLPAM 301
            |..|        |:|.|..:..|||.||||||::: .||...:| :.|||:.|.. |....:|.:
  Fly   274 NQSL--------QICAGGYDGVDTCQGDSGGPLMV-TMDNSSVY-LAGITTYGSKNCGQIGIPGI 328

  Fly   302 YTRVHFYLDWIKQQL 316
            |||...:|.|||..|
  Fly   329 YTRTSAFLPWIKAVL 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 86/272 (32%)
Tryp_SPc 73..312 CDD:214473 83/269 (31%)
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 83/269 (31%)
Tryp_SPc 90..342 CDD:238113 86/271 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437536
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.