DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and CG5255

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:253 Identity:61/253 - (24%)
Similarity:110/253 - (43%) Gaps:36/253 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 IIGGGPAVPKEFPHAARLGHKDENGEVEWFCGGTLISDRHVLTAAHCHYSPQGSVNIARLGDLEF 137
            |:||..|.....|:...|   ...|.....|||.:|.:|.::|||||....|.:......|..:.
  Fly    30 IVGGEEAAAGLAPYQISL---QGIGSGAHSCGGAIIDERWIITAAHCTRGRQATAFRVLTGTQDL 91

  Fly   138 DTNNDDADPEDFDVKDFTAHPEFSYPAIYNDISVVRLSRPVTFNDYKHPACLPFDDGRLGTSFIA 202
            ..|.......|..|:    |..::.....|||:::.|:..:.|::...|..|..:....|:..:.
  Fly    92 HQNGSKYYYPDRIVE----HSNYAPRKYRNDIALLHLNESIVFDNATQPVELDHEALVPGSRLLL 152

  Fly   203 IGWGQLEI---VPRTENKKLQKVKLYNY--GTRCRITADRNDELPEGYNATTQLCIGSNEHKDTC 262
            .|||.|.:   ||    .:||.::: ||  ..:||...|.:..:..|:     :|..:::.:..|
  Fly   153 TGWGTLSLGGDVP----ARLQSLEV-NYVPFEQCRAAHDNSTRVDIGH-----VCTFNDKGRGAC 207

  Fly   263 NGDSGGPVLIYHMDYPCMYH---VMGITSIGVACDTPDLPAMYTRVHFYLDWIKQQLA 317
            :||||||::          |   ::.:.:.|:.| ....|..:..:.:|.|:|:..|:
  Fly   208 HGDSGGPLV----------HNGKLVALVNWGLPC-AKGYPDAHASISYYHDFIRTHLS 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 60/249 (24%)
Tryp_SPc 73..312 CDD:214473 59/246 (24%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 59/246 (24%)
Tryp_SPc 30..252 CDD:238113 60/249 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437665
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.