DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and CG3505

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster


Alignment Length:272 Identity:84/272 - (30%)
Similarity:122/272 - (44%) Gaps:66/272 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 KEFPHAARLGHKDENGEVEWFCGGTLISDRHVLTAAHCHYSPQGS---VNIARLGDLEFDTNND- 142
            :|||..|.:.:...|.|....|||.|||||:|||||||......|   :...|||:.:..||.| 
  Fly   116 REFPWLALIEYTRGNQEKIHACGGVLISDRYVLTAAHCVAQAATSNLQITAVRLGEWDTSTNPDC 180

  Fly   143 ---------DADP--EDFDVKDFTAHPEFSYP--AIYNDISVVRLSRPVTFNDYKHPACLPFDDG 194
                     |..|  :|..:::...||.::..  ...|||::|||:.|...||:..|.|||    
  Fly   181 QYHEDSKVADCAPPYQDIAIEELLPHPLYNRTDRTQINDIALVRLASPAKLNDFVQPICLP---- 241

  Fly   195 RLGTSFIAIGWGQLEIVPRTENKKLQKVKLYNYGT-----------RCR---ITADRNDELPEGY 245
                                 ||:|:..:|.:..|           |.|   :|....:|....|
  Fly   242 ---------------------NKQLRADELEDLVTEVAGWQASSSQRMRKGYVTISSIEECQRKY 285

  Fly   246 NATTQLCIGSNE-----HKDTCNGDSGGPVLIYHMDYPCMYHVMGITSIG-VACDTPDLPAMYTR 304
             |:.||.|.:::     :...|.|::|||::::..|   .|.:.|:.|.| |.|..||.|.:|||
  Fly   286 -ASQQLRIQASKLCGLTNSQECYGNAGGPLMLFKND---GYLLGGLVSFGPVPCPNPDWPDVYTR 346

  Fly   305 VHFYLDWIKQQL 316
            |..|:|||...|
  Fly   347 VASYIDWIHDSL 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 83/269 (31%)
Tryp_SPc 73..312 CDD:214473 81/266 (30%)
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 83/268 (31%)
Tryp_SPc 111..354 CDD:214473 81/266 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437551
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.