DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and CG31326

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster


Alignment Length:268 Identity:78/268 - (29%)
Similarity:120/268 - (44%) Gaps:37/268 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 SYAPLIIGGGPAVPKEFPHAARLGHKDENGEVEWFCGGTLISDRHVLTAAHCHYSPQGSVNIARL 132
            |..|||..|......:.|....:..:.|:....:.|||||||...||:||||..:|...:..:||
  Fly   269 STTPLIFQGKSLQRGQLPWLVAIFERRESNGPAFICGGTLISTSTVLSAAHCFRAPGRDLPASRL 333

  Fly   133 G-DLEFDTNNDDADPEDFDVKDFTAHPEFSYPAIYN-DISVVRLSRPVTFNDYKHPACLPFDDGR 195
            . .|..:|....:|.|...|.....|..|.:..... |:::|||..||.:.||..|.||.....|
  Fly   334 AVSLGRNTLAIHSDGEFRGVSQLIIHENFQFKQFTEADLALVRLDEPVRYTDYIVPICLWSTSNR 398

  Fly   196 LG-----TSFIAIGWGQLEIVPRTENKKLQKVKLYNYGTRCRITADRND--ELPEGYNATTQLCI 253
            :.     .|::| |||..|  ..|.|.::.||      |...|.::.|.  |||......:.||.
  Fly   399 MDLPQGLKSYVA-GWGPDE--TGTGNTEVSKV------TDLNIVSEANCALELPHVLVQPSSLCA 454

  Fly   254 GSNEHKDT----CNGDSGGPVLIYHMDYPCMYHVMGITSIGV------ACDTPDLPAMYTRVHFY 308
                 |.|    |..|.|||:::...|   ::.:.|:.|.||      .|:. ..|:::|.|..:
  Fly   455 -----KKTGAGPCASDGGGPLMLREQD---VWVLRGVISGGVINEKENTCEL-SKPSVFTDVAKH 510

  Fly   309 LDWIKQQL 316
            ::|::|::
  Fly   511 IEWVRQKM 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 74/260 (28%)
Tryp_SPc 73..312 CDD:214473 73/257 (28%)
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 73/257 (28%)
Tryp_SPc 277..514 CDD:214473 72/254 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437182
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.