DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and CG11670

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001368950.1 Gene:CG11670 / 41608 FlyBaseID:FBgn0038114 Length:431 Species:Drosophila melanogaster


Alignment Length:272 Identity:84/272 - (30%)
Similarity:132/272 - (48%) Gaps:61/272 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 GGGPAVPKEFPHAARLGHKDENGEVEWFCGGTLISDRHVLTAAHCHYSPQGSVNIARLGDLEFDT 139
            |.....|.::||.|.||.::||.|:::.|||:|||:..|||||||..:...|.:|.::||::...
  Fly   172 GRSIVAPGQYPHMAALGFRNENHEIDYKCGGSLISEEFVLTAAHCLTTHGTSPDIVKIGDIKLKE 236

  Fly   140 NNDDADPEDFDVKDFTAHPEFSYPAIYNDISVVRLSRPVTFNDYKHPACL-PFDD---GRLGTSF 200
            ...:..|:...|.....||.::....|:||.:::|:|||.:..:..|..| |.:|   |:|.|  
  Fly   237 WELNVAPQRRRVAQIYLHPLYNASLNYHDIGLIQLNRPVEYTWFVRPVRLWPMNDIPYGKLHT-- 299

  Fly   201 IAIGWG---------------QLEIVPRTENKKLQKVKLYNYGTRCRITADRNDELPEGYNATTQ 250
              :|:|               .|.:||..:               |..:...::..|.|. .|:|
  Fly   300 --MGYGSTGFAQPQTNILTELDLSVVPIEQ---------------CNSSLPADEGSPHGL-LTSQ 346

  Fly   251 LCIGSNE-HKDTCNGDSGGPVLI--------------YHMDYPCMYHVMGITSIGVACDTPDLPA 300
            :|....| ::|||.||||||:.:              |.      |:::||||.|..|.: :||.
  Fly   347 ICAHDYEKNRDTCQGDSGGPLQLNLERRRRRHTSRKHYR------YYLVGITSYGAYCRS-ELPG 404

  Fly   301 MYTRVHFYLDWI 312
            :||||..|:|||
  Fly   405 VYTRVSSYIDWI 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 84/272 (31%)
Tryp_SPc 73..312 CDD:214473 82/270 (30%)
CG11670NP_001368950.1 Tryp_SPc 172..419 CDD:238113 84/272 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.