DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and snk

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster


Alignment Length:257 Identity:93/257 - (36%)
Similarity:138/257 - (53%) Gaps:12/257 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 KCTSYAPLIIGGGPAVPKEFPHAARLGHKDENG----EVEWFCGGTLISDRHVLTAAHCHYSPQG 125
            :|....|||:||.|.....|||.|.||....:|    :::|.|||.|:|:.:|||||||..|...
  Fly   178 QCVPSVPLIVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTAAHCATSGSK 242

  Fly   126 SVNIARLGDLEFDTNNDDADPEDFDVKDFTAHPEFSYPAIYNDISVVRLSRPVTFNDYKHPACL- 189
            ..::.|||..:.  |...|..:|..:.....||::...|.|:||::::|:|.|.|::...|||| 
  Fly   243 PPDMVRLGARQL--NETSATQQDIKILIIVLHPKYRSSAYYHDIALLKLTRRVKFSEQVRPACLW 305

  Fly   190 PFDDGRLGTSFIAIGWGQLEIVPRTENKKLQKVKL-YNYGTRCRITADRNDELPEGYNATTQLCI 253
            ...:.::.| .:|.|||:.|.:....| .|::|.| ......|:....:...||.|. ...|.|.
  Fly   306 QLPELQIPT-VVAAGWGRTEFLGAKSN-ALRQVDLDVVPQMTCKQIYRKERRLPRGI-IEGQFCA 367

  Fly   254 G-SNEHKDTCNGDSGGPVLIYHMDYPCMYHVMGITSIGVACDTPDLPAMYTRVHFYLDWIKQ 314
            | ....:|||.||||||:.....:|.|:..|:||||.|..|..|:.|.:|||::.|||||::
  Fly   368 GYLPGGRDTCQGDSGGPIHALLPEYNCVAFVVGITSFGKFCAAPNAPGVYTRLYSYLDWIEK 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 90/249 (36%)
Tryp_SPc 73..312 CDD:214473 88/245 (36%)
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 90/249 (36%)
Tryp_SPc 186..427 CDD:214473 88/245 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437674
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4773
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
66.000

Return to query results.
Submit another query.