DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and CG11668

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_650254.1 Gene:CG11668 / 41606 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster


Alignment Length:285 Identity:81/285 - (28%)
Similarity:135/285 - (47%) Gaps:37/285 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 IENAPIIYKTLDKCTSYAPLIIGGGPAVPKEFPHAARLG-----------HKDENGEVEWFCGGT 106
            ::...::...:.|......|::||......|.|:...||           |........:.||..
  Fly   128 LDQVELVEPIIQKHNQSQNLLVGGRLTQENEHPYMCALGWPSRTNRWIHEHGSSKRRYTFNCGCA 192

  Fly   107 LISDRHVLTAAHCHYSPQGSVNIARLGDLEFDTNNDDADPEDFDVKDFTAHPEFSYPAIYNDISV 171
            :|:.|..:|||||......|.::|.:|.:|.::.....    .::|..:.||.|....:.||::|
  Fly   193 MIAPRFAITAAHCASVGGESPSVALIGGVELNSGRGQL----IEIKRISQHPHFDAETLTNDLAV 253

  Fly   172 VRLSR----PVTFNDYKHPACLPFDDGRLGTSFIAIGWGQLEIV-PRTENKKLQKVKLYNYG-TR 230
            |:|:|    ||        |||...:........|:|:||.:.. |.:.|  |.::.||:.. .:
  Fly   254 VKLARRSHMPV--------ACLWNQESLPERPLTALGYGQTKFAGPHSSN--LLQIMLYHLNFQQ 308

  Fly   231 CRITADRNDELPEGYNATTQLCIGS-NEHKDTCNGDSGGPVLIY-HMDY--PCMYHVMGITSIGV 291
            |:......|:|..|. .:.|:|.|. :.:.|||.||||||:|:: ||.:  ..:.:|:||||.|.
  Fly   309 CQRYLHNYDKLANGL-GSGQMCAGDYSGNMDTCQGDSGGPLLLHQHMRHHRHTIPYVVGITSFGG 372

  Fly   292 ACDTPDLPAMYTRVHFYLDWIKQQL 316
            ||.:.. |.:|.|:..|:.||:||:
  Fly   373 ACASGQ-PGVYVRIAHYIQWIEQQV 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 77/262 (29%)
Tryp_SPc 73..312 CDD:214473 75/259 (29%)
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 77/261 (30%)
Tryp_SPc 149..392 CDD:214473 75/258 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25874
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.