DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and MP1

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:288 Identity:86/288 - (29%)
Similarity:127/288 - (44%) Gaps:61/288 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 SYAPLIIGGGPAVPKEFPHAARLGHKDENGEVEWFCGGTLISDRHVLTAAHCHYSPQGSVNI--A 130
            ::...::||.....:|||..|.:.:..........|||:||:.|:|||||||..:......:  .
  Fly   133 NFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSAIPSDWELTGV 197

  Fly   131 RLGDLEFDTNND---------DADPE--DFDVKDFTAHPEFSYPA----IYNDISVVRLSRPVTF 180
            |||:.:..||.|         |.:..  |:.|::...||:  ||.    ..|||:::||...|.:
  Fly   198 RLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQ--YPGNSRDQLNDIALLRLRDEVQY 260

  Fly   181 NDYKHPACLP-----FDDGRLGTSFIAIGWGQLEIVPRTENKKLQKVKL-------------YNY 227
            :|:..|.|||     .::..||...:..|||      |||......:||             ..|
  Fly   261 SDFILPVCLPTLASQHNNIFLGRKVVVAGWG------RTETNFTSNIKLKAELDTVPTSECNQRY 319

  Fly   228 GTRCRITADRNDELPEGYNATTQLCIGSNEHKDTCNGDSGGPVLIYHMDYP---CMYHVMGITSI 289
            .|:.|..            .|.|:|.|..|..|:|.||||||:|:  .||.   ..|::.|:.|.
  Fly   320 ATQRRTV------------TTKQMCAGGVEGVDSCRGDSGGPLLL--EDYSNGNSNYYIAGVVSY 370

  Fly   290 G-VACDTPDLPAMYTRVHFYLDWIKQQL 316
            | ..|.....|.:||||..||:||:..:
  Fly   371 GPTPCGLKGWPGVYTRVEAYLNWIENNV 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 86/280 (31%)
Tryp_SPc 73..312 CDD:214473 84/277 (30%)
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 84/278 (30%)
Tryp_SPc 138..397 CDD:238113 86/280 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437557
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.