DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and Jon74E

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster


Alignment Length:255 Identity:80/255 - (31%)
Similarity:116/255 - (45%) Gaps:39/255 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 IIGGGPAVPKEFPHAARLGHKDENGEVEWFCGGTLISDRHVLTAAHC-------HYSPQGSVNIA 130
            |.||..|...:||:...|..::.|....| ||.:|||||::||||||       .|...|.:.:|
  Fly    32 IAGGELARANQFPYQVGLSIEEPNDMYCW-CGASLISDRYLLTAAHCVEKAVAITYYLGGVLRLA 95

  Fly   131 RLGDLEFDTNNDDADPEDFDVKDFTAHPEFSYPAIYNDISVVRLSRPVTFNDYKHPACLP-FDDG 194
            . ..|...||     ||      ...||:::..::.|||::|||.......|...|..|| ....
  Fly    96 P-RQLIRSTN-----PE------VHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSS 148

  Fly   195 RLGTSF---IAIGWGQLEIVPRTENKKLQKVKLYNYGTRCRITADRNDELPEGYN--ATTQLCIG 254
            |....:   ||.|||::.......:..|:.|  |.:       .:.|::....|.  ..|.:|:.
  Fly   149 RNSYDYVPAIASGWGRMNDESTAISDNLRYV--YRF-------VESNEDCEYSYANIKPTNICMD 204

  Fly   255 SNEHKDTCNGDSGGPVLIYHMDYPCMYHVMGITSIG--VACDTPDLPAMYTRVHFYLDWI 312
            :...|.||.|||||| |:|.........::|:||.|  ..| |...|:::||:..|||||
  Fly   205 TTGGKSTCTGDSGGP-LVYSDPVQNADILIGVTSYGKKSGC-TKGYPSVFTRITAYLDWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 80/255 (31%)
Tryp_SPc 73..312 CDD:214473 78/253 (31%)
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 78/253 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.