DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and CG18179

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster


Alignment Length:256 Identity:68/256 - (26%)
Similarity:107/256 - (41%) Gaps:49/256 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 IIGGGPAVPKEFPHAARLGHKDENGEVEWFCGGTLISDRHVLTAAHC--------HYSPQGSVNI 129
            |:.|.||...:.|:...|..:.:.........||:|:...:||||||        ||......| 
  Fly    40 IVNGYPAPEGKAPYIVGLLIRTDGSNSAAVGAGTIIASDWILTAAHCLTTDYVEIHYGSNWGWN- 103

  Fly   130 ARLGDLEFDTNNDDADPEDFDVKDFTAHPEFSYPAI-YNDISVVRLSRPVTFNDYKHPACLPF-- 191
               |........|          :|.:||  ::||. ..||.::| :..|.|.|..:...||.  
  Fly   104 ---GAFRQSVRRD----------NFISHP--NWPAEGGRDIGLIR-TPSVGFTDLINKVALPSFS 152

  Fly   192 --DDGRLGTSFIAIGWGQLEIVPRTENKKLQKVKLYNYGTRCRITADRNDELPEGYN--ATTQLC 252
              .|..:.|..:|.|||.::.....:..:...|::.:           |.|..:.|.  |:|.:|
  Fly   153 EESDRFVDTWCVACGWGGMDNGNLADWLQCMDVQIIS-----------NSECEQSYGTVASTDMC 206

  Fly   253 IGSNEHKDTCNGDSGGPVLIYHMDYPCMYHVMGITSIGVACDTPDLPAMYTRVHFYLDWIK 313
            ....:.|.:|.|||||| |:.|.:    ..::|:.:.| :.|....|:.||||..||.||:
  Fly   207 TRRTDGKSSCGGDSGGP-LVTHDN----ARLVGVITFG-SVDCHSGPSGYTRVTDYLGWIR 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 68/256 (27%)
Tryp_SPc 73..312 CDD:214473 66/253 (26%)
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 66/253 (26%)
Tryp_SPc 40..263 CDD:238113 68/256 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437119
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.