DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and CG8329

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster


Alignment Length:265 Identity:81/265 - (30%)
Similarity:118/265 - (44%) Gaps:66/265 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 LIIGGGPAVPKEFPHAARLGHKDENGEVEWFCGGTLISDRHVLTAAHC--------HYSPQGSVN 128
            :|:.|.||...:.|:|  :|.:..||.|.   ||::|.:..|||||||        ||   || |
  Fly    34 IIVNGYPAYEGKAPYA--VGLRMNNGAVG---GGSVIGNNWVLTAAHCLTTDSVTIHY---GS-N 89

  Fly   129 IARLGDLEFDTNNDDADPEDFDVKDFTAHPEFSYP-AIYNDISVVRLSRPVTFNDYKHPACLPFD 192
            .|..|.|:...|.:          :|..||  .|| :..:||.::| :..|:|.:..:...|| .
  Fly    90 RAWNGQLQHTVNKN----------NFFRHP--GYPNSAGHDIGLIR-TPYVSFTNLINKVSLP-K 140

  Fly   193 DGRLGTSF-----IAIGWGQLEIVPRTENKKLQKVKLYNYG----TRCR-ITADRNDELPEGYN- 246
            ..:.|..|     :|.|||.:.                |.|    .:|. :....|.|....|. 
  Fly   141 FSQKGERFENWWCVACGWGGMA----------------NGGLADWLQCMDVQVISNGECARSYGS 189

  Fly   247 -ATTQLCIGSNEHKDTCNGDSGGPVLIYHMDYPCMYHVMGITSIGVACDTPDLPAMYTRVHFYLD 310
             |:|.:|..:.:.|..|.||||| .|:.| |.|....|:...|||  |.:.  |:.||||..:||
  Fly   190 VASTDMCTRATDGKSVCGGDSGG-ALVTH-DNPIQVGVITFASIG--CKSG--PSGYTRVSDHLD 248

  Fly   311 WIKQQ 315
            ||:::
  Fly   249 WIREK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 81/262 (31%)
Tryp_SPc 73..312 CDD:214473 79/259 (31%)
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 81/262 (31%)
Tryp_SPc 35..250 CDD:214473 79/259 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437122
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.