DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and Jon66Ci

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster


Alignment Length:299 Identity:69/299 - (23%)
Similarity:104/299 - (34%) Gaps:117/299 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 KTLDKCTSYAPLIIGGGPAVPKEFPHAARLGHKDENGEVEWFCGGTLISDRHVLTAAHC------ 119
            |.|.|.......|..|.||...:.|:...||...     .|:|||::||:..||||.||      
  Fly    25 KDLSKVAKIEGRITNGYPAEEGKAPYTVGLGFSG-----GWWCGGSIISNEWVLTAEHCIGGDAV 84

  Fly   120 ---------------------HYSPQGSVNIA--RLGDLEFDTNNDDADPEDFDVKDFTAHPEFS 161
                                 ::...||.:||  |:..::|           :.:.:....|  |
  Fly    85 TVYFGATWRTNAQFTHWVGSGNFITHGSADIALIRIPHVDF-----------WHMVNKVELP--S 136

  Fly   162 YPAIYNDISVVRLSRPVTFNDYKHPACLPFDDGRLGTSFIAIGWG---------------QLEIV 211
            |...|||           :|::...||               |||               .|:|:
  Fly   137 YNDRYND-----------YNEWWAVAC---------------GWGGTYDGSPLPDYLQCVDLQII 175

  Fly   212 PRTENKKLQKVKLYNYGTRCRITADRNDELPEGYNATTQLCIGSNEHKDTCNGDSGGPVLIYHMD 276
            ..:|....       |||              |......:|:...:.|.||.||||||::.:...
  Fly   176 HNSECASY-------YGT--------------GTVGDNIICVRVVDGKGTCGGDSGGPLVTHDGS 219

  Fly   277 YPCMYHVMGITS--IGVACDTPDLPAMYTRVHFYLDWIK 313
                 .::|:|:  .|..|.... ||.:.||.::||||:
  Fly   220 -----KLVGVTNWVSGAGCQAGH-PAGFQRVTYHLDWIR 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 66/287 (23%)
Tryp_SPc 73..312 CDD:214473 64/284 (23%)
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 64/285 (22%)
Tryp_SPc 37..254 CDD:238113 66/287 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437110
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.