DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and CG10469

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster


Alignment Length:264 Identity:78/264 - (29%)
Similarity:118/264 - (44%) Gaps:50/264 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 IIGGGPAVPKEFPHAARL-----GHKDENGEVEWFCGGTLISDRHVLTAAHCHYSPQGSV--NIA 130
            |:.|..|..|:.|:...|     |.|||..    .||||::|:|.::|||||...|:.::  .:.
  Fly    24 IMNGTAAKAKQLPYQVGLLCYFEGSKDEPN----MCGGTILSNRWIITAAHCLQDPKSNLWKVLI 84

  Fly   131 RLGDLE-FDTNNDDADPEDFDVKDFT-AHPEFSYPAIYNDISVVRLSRPVTFNDYKHPACLP-FD 192
            .:|.:: ||      |.|....:.:| .|.:|....:.|||::::|.:.:|||.|..||.|| ..
  Fly    85 HVGKVKSFD------DKEIVVNRSYTIVHKKFDRKTVTNDIALIKLPKKLTFNKYIQPAKLPSAK 143

  Fly   193 DGRLGTSFIAIGWG-----------QLEIVPRTENKKLQKVKLYNYGTRCRITADRNDELPEGYN 246
            ....|...|..|||           |....|...||:.::......|.:.:      ..:..|: 
  Fly   144 KTYTGRKAIISGWGLTTKQLPSQVLQYIRAPIISNKECERQWNKQLGGKSK------KVVHNGF- 201

  Fly   247 ATTQLCIGSNEHKDTCNGDSGGPVLIYHMDYPCMYHVMGITSIGV--ACDTPDLPAMYTRVHFYL 309
                :||.|.:.. .|.||||||:::......    ::||.|.|.  .|.. .||.:.|||..||
  Fly   202 ----ICIDSKKGL-PCRGDSGGPMVLDDGSRT----LVGIVSHGFDGECKL-KLPDVSTRVSSYL 256

  Fly   310 DWIK 313
            .|||
  Fly   257 KWIK 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 78/264 (30%)
Tryp_SPc 73..312 CDD:214473 75/261 (29%)
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 75/261 (29%)
Tryp_SPc 24..260 CDD:238113 76/262 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437173
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.