DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and CG10472

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster


Alignment Length:313 Identity:90/313 - (28%)
Similarity:137/313 - (43%) Gaps:50/313 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VLLVSFVAWASAQDSDIARTCTAYKRSVWEETSEFSFLIENAPIIYKTLDKCTSYAPLIIGGGPA 79
            |||::.:..|.|.|              |......:.......:..:||.     :..|.||..|
  Fly     8 VLLLATILGAQAVD--------------WNSVKNLNIETPMPKVHGETLP-----SGRITGGQIA 53

  Fly    80 VPKEFPHAARLGHKDENGEVEWFCGGTLISDRHVLTAAHCHYSPQGSVNIARLGDLEFDTNNDDA 144
            .|.:||:...| .....|...| ||||:||||.::|||||..|....|:: .||  ..|..|...
  Fly    54 EPNQFPYQVGL-LLYITGGAAW-CGGTIISDRWIITAAHCTDSLTTGVDV-YLG--AHDRTNAKE 113

  Fly   145 DPEDF---DVKDFTAHPEFSYPAIYNDISVVRLSRPVTFNDYKHPACLPFDDGRL----GTSFIA 202
            :.:..   :.|:...|.::....|.||||:::|..|:.||.|..||.||......    |.:.||
  Fly   114 EGQQIIFVETKNVIVHEDWIAETITNDISLIKLPVPIEFNKYIQPAKLPVKSDSYSTYGGENAIA 178

  Fly   203 IGWGQLEIVPRTENKKLQKVKLYNYGTRCRITADRNDELPE---GYNATTQLCIGSNEHKDTCNG 264
            .|||::      .:.......:..|.|   :....|.....   |..|.:.:||.:.....||||
  Fly   179 SGWGKI------SDSATGATDILQYAT---VPIMNNSGCSPWYFGLVAASNICIKTTGGISTCNG 234

  Fly   265 DSGGPVLIYHMDYPCMYHVMGITSIGVA--CDTPDLPAMYTRVHFYLDWIKQQ 315
            |||||:::......    ::|.||.|:|  |:. ..|.::||:.:|||||:::
  Fly   235 DSGGPLVLDDGSNT----LIGATSFGIALGCEV-GWPGVFTRITYYLDWIEEK 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 81/253 (32%)
Tryp_SPc 73..312 CDD:214473 79/250 (32%)
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 79/251 (31%)
Tryp_SPc 47..282 CDD:238113 81/253 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437158
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.