DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and yip7

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster


Alignment Length:276 Identity:79/276 - (28%)
Similarity:118/276 - (42%) Gaps:40/276 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LIEN-APIIYKTLDKCTSYAPLIIGGGPAVPKEFPHAARLGHKDENGEVEWFCGGTLISDRHVLT 115
            |:.| ||:..:......|....|..|..||..:||:...|......|  .|:|||::|.:..|||
  Fly    18 LLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAG--SWWCGGSIIGNEWVLT 80

  Fly   116 AAHCHYSPQGSVNIARLGDLEFDTNNDDADPEDFDV---KDFTAHPEFSYPAIYNDISVVR---L 174
            ||||   ..|:.::.........|:     ||...|   ..|..|..:....|.||||:::   :
  Fly    81 AAHC---TDGAASVTIYYGATVRTS-----PEFTQVVSSSKFRQHESYLALTIRNDISLIQTSSV 137

  Fly   175 SRPVTFNDYKHPACLPFDDGRLGTSFIAIGWGQLEIVPRTENKKLQKVKLYNYGTRCRITADRND 239
            |...|.|....||.........|.:.:|.|||.........::.||.|.|         |...|.
  Fly   138 SFSATVNKISLPAVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYVDL---------TIISNS 193

  Fly   240 ELPEGYNA----TTQLCIGSNEHKDTCNGDSGGPVLIYHMDYPCMYHVMGITSIGVA--CDTPDL 298
            :..|.:.:    :..||:.:.....||.||||||:.:..:       ::|.||.|.|  |:: ..
  Fly   194 KCQETFGSLIVTSRVLCVDTTNKASTCQGDSGGPLALDGV-------LIGATSFGSADGCES-GA 250

  Fly   299 PAMYTRVHFYLDWIKQ 314
            ||.:||:.:|.||||:
  Fly   251 PAAFTRITYYRDWIKE 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 74/254 (29%)
Tryp_SPc 73..312 CDD:214473 71/250 (28%)
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 71/251 (28%)
Tryp_SPc 40..267 CDD:238113 74/254 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437146
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.