DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and CG10477

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster


Alignment Length:296 Identity:79/296 - (26%)
Similarity:116/296 - (39%) Gaps:67/296 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 TSEFSFLIENAPIIYKTLDKCTSYAPLIIGGGPAVPKEFPHAARLGHKDENGEVEWFCGGTLISD 110
            |.....|.::.|:..:......|....|..|..|...:||:...|..|...|  .|:|||::|::
  Fly    13 TVSADILRQDTPVHPRDSSAVPSIDGRITNGNKAAANQFPYQVGLSFKSSAG--SWWCGGSIIAN 75

  Fly   111 RHVLTAAHCHYSPQGSVNI---------ARLGDLEFDTNNDDADPEDFDVKDFTAHPEFSYPAIY 166
            ..||||||| .....||.|         |:|             .:......|..|..::...:.
  Fly    76 TWVLTAAHC-TKGASSVTIYYGSTVRTSAKL-------------KKKVSSSKFVQHAGYNAATLR 126

  Fly   167 NDISVVR---LSRPVTFNDYKHPACLPFDDGRLGTSFIAIGWGQLEIVPRTENKKLQKVKLYNYG 228
            ||||:::   ::..|:.|....||.........|.:.:|.|||      ||.:..:.......|.
  Fly   127 NDISLIKTPSVTFTVSINKIALPAIASSYSTYAGQTAVASGWG------RTSDSSIAVATNLQYA 185

  Fly   229 TRCRITADRNDELPEGYNATTQ------------LCIGSNEHKDTCNGDSGGPVLIYHMDYPCMY 281
            ....||           ||..|            :|:.|...|.||.||||||:.:.:       
  Fly   186 QFQVIT-----------NAVCQKTFGSSVVTSGVICVESINKKSTCQGDSGGPLALNN------- 232

  Fly   282 HVMGITSI--GVACDTPDLPAMYTRVHFYLDWIKQQ 315
            .::|:||.  ...|: .:.||.:|||..||||||.|
  Fly   233 RLIGVTSFVSSKGCE-KNAPAGFTRVTSYLDWIKNQ 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 74/267 (28%)
Tryp_SPc 73..312 CDD:214473 71/264 (27%)
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 71/265 (27%)
Tryp_SPc 40..267 CDD:238113 74/267 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437149
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.030

Return to query results.
Submit another query.