DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and CG15873

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster


Alignment Length:285 Identity:73/285 - (25%)
Similarity:105/285 - (36%) Gaps:95/285 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 LIIGGGPAVPKEFPHAARLG-------------HKDENGEVEWFCGGTLISDRHVLTAAHC---- 119
            ::|.||..     |.:.||.             |:.:|    .||.|.|:|.|.|||||||    
  Fly    34 MLISGGYK-----PKSNRLSRHVVSIRTKNYVRHRGDN----HFCSGVLVSSRAVLTAAHCLTDR 89

  Fly   120 ---HYSPQG----SVNIARLGDLEFDTNNDDADPEDF-DVKDFTAHPEFS-YPAIYNDISVVRLS 175
               ..:|:|    ..:|.||...         |..|| .|.....|||:. |..  ||::::|||
  Fly    90 YKASMNPRGIRVVFGHITRLAVY---------DESDFRSVDRLVVHPEYERYKK--NDLAILRLS 143

  Fly   176 RPVTFNDYKHPACLPF-----DDGRLGTSFIAIGWGQ-------------LEIVPRTENKKLQKV 222
            ..|..:::.   .||.     .:...|.:.|.:||||             |:::.|..: ..|| 
  Fly   144 ERVQSSNHD---VLPLLMRKTANVTYGDTCITLGWGQIYQHGPYSNELVYLDVILRPPS-LCQK- 203

  Fly   223 KLYNYGTRCRITADRNDELPEGYNATTQLCIGSNEHKDTCNGDSGGPVLIYHMDYPCMYHVMGIT 287
               :|.|   .|||.|            :|.........|.||.|||:|       |...:.|:.
  Fly   204 ---HYDT---FTADHN------------VCTEPVGESMNCAGDMGGPLL-------CKGALFGLI 243

  Fly   288 SIGVACDTPDLPAMYTRVHFYLDWI 312
            ...:.| .......:....:|.|||
  Fly   244 GGHMGC-AGGKAMKFLSFLYYKDWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 73/284 (26%)
Tryp_SPc 73..312 CDD:214473 71/282 (25%)
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 69/264 (26%)
Tryp_SPc 59..250 CDD:238113 63/236 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437197
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.