DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and try-9

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001021891.1 Gene:try-9 / 3565941 WormBaseID:WBGene00023425 Length:279 Species:Caenorhabditis elegans


Alignment Length:258 Identity:66/258 - (25%)
Similarity:101/258 - (39%) Gaps:71/258 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 GHKDENGEVEWFCGGTLISDRHVLTAAHCHYSPQGSVNIARLGDLEFDTNNDDADPEDFDVKDF- 154
            |:|....|......|||:|..|::||||.       :.|:.....:.||.|   ..|.:.|:|: 
 Worm    16 GNKFSENEFVQHGTGTLVSPWHIVTAAHL-------IGISEDPLPDCDTGN---LREAYFVRDYK 70

  Fly   155 ---------TAHPE----------FSYPAI-------------------YNDISVVRLSRPVTFN 181
                     .|.||          |...||                   :|||:|..|..|:.|:
 Worm    71 NFVAFVNVTCAVPEMCKGLHRKDMFKPLAIKSLYIRKGYVGDGCIDRESFNDIAVFELEEPIEFS 135

  Fly   182 DYKHPACLPFDD--GRL-GTSFIAIGWGQLEIVPRTENKKLQKVKLYNYGTRCRITADRNDELPE 243
            ....|||||...  .|: .|.:...|:|:.......|:.||:  .||::...|      :|:.|.
 Worm   136 KDIFPACLPSAPKIPRIRETGYKLFGYGRDPSDSVLESGKLK--SLYSFVAEC------SDDFPY 192

  Fly   244 G--YNATTQLCIGSNEHKDTCNGDSGGPVLIYHMDYPCMYHVMGITSIGVACDTPDLPAMYTR 304
            |  |      |..:.....:|:||||..| :...|...:..::|:.|.|:.|  |:|...:.|
 Worm   193 GGVY------CTSAVNRGLSCDGDSGSGV-VRTSDTRNVQVLVGVLSAGMPC--PELYDTHNR 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 66/258 (26%)
Tryp_SPc 73..312 CDD:214473 66/258 (26%)
try-9NP_001021891.1 Tryp_SPc 30..237 CDD:389826 59/231 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.