DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and scaf

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster


Alignment Length:192 Identity:44/192 - (22%)
Similarity:80/192 - (41%) Gaps:37/192 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 DEN-GEVEW------------FCGGTLISDRHVLTAAHC-HYSPQGSVNIARLGDLEFDTNNDDA 144
            |.| .|:.|            .|||.:|.|:.||::|.| :..|...:.: :.|:.|..:.|:..
  Fly   428 DANFAEIPWQAMILRESSKTLICGGAIIGDQFVLSSASCVNGLPVTDIRV-KAGEWELGSTNEPL 491

  Fly   145 DPEDFDVKDFTAHPEFSYPAIYNDISVVRLSRPVTFNDYKHPACLPFDDGRLGTSFIAIGWGQLE 209
            ..:...||....||::......:|::::||.|.:.|..:..|.|:..:|.:........|||:  
  Fly   492 PFQLTGVKTVDVHPDYDPSTNSHDLAIIRLERRLEFASHIQPICISDEDPKDSEQCFTSGWGK-- 554

  Fly   210 IVPRTENKKLQKVKLYNYGTRCRITADRNDELPEGYNA----TTQLCIGSNEHKDTCNGDSG 267
                      |.:.::..|....:|    |.||:..:.    ::.:|  |....|:|..|.|
  Fly   555 ----------QALSIHEEGALMHVT----DTLPQARSECSADSSSVC--SATKFDSCQFDVG 600

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 44/192 (23%)
Tryp_SPc 73..312 CDD:214473 44/192 (23%)
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 44/192 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435584
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.