DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and CG4650

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:237 Identity:55/237 - (23%)
Similarity:98/237 - (41%) Gaps:52/237 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 EVEWFCGGTLISDRHVLTAAHCHYSPQGSVNIARLGDLEFDTNNDDADP---EDFDVKDFTAHPE 159
            |:.:.||||:|:::.|||||||..:.:..|  ||:|:.   ...|||:.   .::.|.....|..
  Fly    52 ELLYVCGGTVITEKLVLTAAHCTRASEQLV--ARIGEF---IGTDDANDTMLSEYQVSQTFIHSL 111

  Fly   160 FSYPAIYNDISVVRLSRPVTFNDYKHPACLPFDDGRLGTSFIAIGWGQLEIVPRTENKKLQKVKL 224
            ::.....|||:::.|:..:.|:....|.|:             :.|       ....|.:..:::
  Fly   112 YNTTTSANDIAILGLATDIVFSKTIRPICI-------------VWW-------TIWRKYIDNIQV 156

  Fly   225 YNYGTRCRITADRND--------------ELPEGYNAT----TQLCIGSNEHKDTCNGDSGGPV- 270
            .: |.:..:..|||:              .:....|.|    :|.|.|.::.| .||.|...|: 
  Fly   157 LS-GAQWGLPNDRNESDAFRITDIRRQPANMCSTLNGTAILSSQFCAGDSDSK-LCNVDFSSPLG 219

  Fly   271 LIYHMDYPCMYHVMGITSIGVACDTPDLPAMYTRVHFYLDWI 312
            .|........|.::||.:....|..   .::||.|..:.|:|
  Fly   220 AIITFKNIQRYVLIGIATTNQKCKR---ASVYTDVLSHTDFI 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 55/237 (23%)
Tryp_SPc 73..312 CDD:214473 54/235 (23%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 54/235 (23%)
Tryp_SPc 33..258 CDD:304450 54/235 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437575
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.