DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and OVCH2

DIOPT Version :10

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_047282834.1 Gene:OVCH2 / 341277 HGNCID:29970 Length:569 Species:Homo sapiens


Alignment Length:31 Identity:9/31 - (29%)
Similarity:14/31 - (45%) Gaps:5/31 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   472 DEASEDGTS-----MAPSLTLKPGITLSAKP 497
            ||.:..|..     .||:..|..|:.::|.|
Human    11 DETAATGDMPTYQIRAPTTALPQGVVMAASP 41

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113
OVCH2XP_047282834.1 Tryp_SPc 56..301 CDD:238113
CUB 320..424 CDD:238001
CUB 435..546 CDD:238001
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.