DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and CG31220

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:274 Identity:77/274 - (28%)
Similarity:123/274 - (44%) Gaps:46/274 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 IIGGGPAVPKEFPHAARLGHKDENG-----EVEWFCGGTLISDRHVLTAAHCHYSPQGSVNIARL 132
            :|||......|:|..|.|.:::.:.     |:...|||:||:.|:|||||||.......:...||
  Fly   104 VIGGTEPNLNEYPWLAMLLYRNRSAFNPDRELVPSCGGSLINTRYVLTAAHCVTDTVLQIQRVRL 168

  Fly   133 GDLEFDTNNDDADPE-----------DFDVKDFTAHPEFSYPAIY---NDISVVRLSRPVTFNDY 183
            |: ...::|.|....           |.||:..|:|.::. ||.|   |||::|||..||.:...
  Fly   169 GE-HTTSHNPDCISRGARIVCAPTHLDIDVESITSHNDYD-PANYTFRNDIALVRLKEPVRYTMA 231

  Fly   184 KHPAC-LPFDDGRLGTSFIAIGWGQLEIVPRTENKKLQKVKLYNYGTR----CRITADRNDELPE 243
            .:|.| |.:....:.......|||              |..:::.|::    ..:...:.:|..|
  Fly   232 YYPICVLDYPRSLMKFKMYVAGWG--------------KTGMFDTGSKVLKHAAVKVRKPEECSE 282

  Fly   244 GY-----NATTQLCIGSNEHKDTCNGDSGGPVL-IYHMDYPCMYHVMGITSIGVACDTPDLPAMY 302
            .|     ....|:|.|..:::.||:||||.|:: .....|..:..:.||||.|..|.|...|:::
  Fly   283 KYAHRHFGPRFQICAGGLDNRGTCDGDSGSPLMGTSGRSYETITFLAGITSYGGPCGTIGWPSVF 347

  Fly   303 TRVHFYLDWIKQQL 316
            ||...:..||:..|
  Fly   348 TRTAKFYKWIRAHL 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 76/271 (28%)
Tryp_SPc 73..312 CDD:214473 74/268 (28%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 74/268 (28%)
Tryp_SPc 104..360 CDD:238113 76/271 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437530
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.