DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and CG8952

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster


Alignment Length:307 Identity:76/307 - (24%)
Similarity:120/307 - (39%) Gaps:83/307 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 ETSEFSFLIENAPIIYKTLDKCTSYAPL-----IIGGGPAVPKEFPHAARLGHKDENGEVEW--- 101
            |.|....|:....::.:..|...| :|:     |:.|..|...:||....| .:|     .|   
  Fly     6 ERSLMLVLLAAISVVGQPFDPANS-SPIKIDNRIVSGSDAKLGQFPWQVIL-KRD-----AWDDL 63

  Fly   102 FCGGTLISDRHVLTAAHCH------YSPQGSVNIARLGDLEFDTNNDDADPEDFDVKDFTAHPEF 160
            .|||::|||..|||||||.      :...|:|::.....|...:||            ...||::
  Fly    64 LCGGSIISDTWVLTAAHCTNGLSSIFLMFGTVDLFNANALNMTSNN------------IIIHPDY 116

  Fly   161 SYPAIYNDISVVRLSRPVTFNDYKHPACLPFDDGRLGTSFIAIG--------------------- 204
            : ..:.||:|:::|..|:||:.......|.   |:.|.|...:|                     
  Fly   117 N-DKLNNDVSLIQLPEPLTFSANIQAIQLV---GQYGDSIDYVGSVATIAGFGYTEDEYLDYSET 177

  Fly   205 --WGQLEIVPRTENKKLQKVKLYNYGTRCRITADRNDELPEGYNATTQLCIGSNEHKDTCNGDSG 267
              :.|:||:...:...:....:....|.|....|.:|                   ..||.||||
  Fly   178 LLYAQVEIIDNADCVAIYGKYVVVDSTMCAKGFDGSD-------------------MSTCTGDSG 223

  Fly   268 GPVLIYHMDYPCMYHVMGITSIGVACD--TPDLPAMYTRVHFYLDWI 312
            ||:::|:.... .:..:||.|. ||.|  |..||:.|.||..:|.:|
  Fly   224 GPLILYNKTIQ-QWQQIGINSF-VAEDQCTYRLPSGYARVSSFLGFI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 70/274 (26%)
Tryp_SPc 73..312 CDD:214473 69/272 (25%)
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 69/273 (25%)
Tryp_SPc 38..271 CDD:238113 70/274 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437176
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.