DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and CG31205

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster


Alignment Length:268 Identity:66/268 - (24%)
Similarity:101/268 - (37%) Gaps:67/268 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 AVPKEFPHAARLGHKDENGEVEWFCGGTLISDRHVLTAAHCHYSPQGSVNIARLGDLEFDTNNDD 143
            |.|.|.|...|:....::|.....|.|.||..|.|:||||| .|...|.:|       :.....|
  Fly    44 AEPTEHPWVVRIVGVTKDGSNTLLCTGILIDSRRVVTAAHC-VSKDESESI-------YGVVFGD 100

  Fly   144 ADPEDFD-VKDFTAHPEFSYPAIYNDISVVRLSRPVTFNDYKHPACLPFDDGRLGTSFIAIGWGQ 207
            :|..:.: |...|.||::|.....||::::.|::.|.|:|...|.|||               ..
  Fly   101 SDSSNINLVSAVTVHPDYSPRKFENDLAIIELTKEVVFSDLVQPICLP---------------SV 150

  Fly   208 LEIVP--RTENKKL---------------------QKVKLYNYGTRCRITA----DRNDELPEGY 245
            .|:||  .|.|.||                     :::|:    |..:|.:    ::....||  
  Fly   151 SEMVPGSETSNSKLIVAGLEGPSFDRRHSATQRLDKRIKM----TYTKIDSKECHEKQARFPE-- 209

  Fly   246 NATTQLCIGSNEHKDTCNGDSGGPVLIYHMDYPCMYHVMGITSIGVACDTPDLPAMYTRVHFYLD 310
                :|..|..|....     .|..|......|..:|::||...|......|... |..:..:||
  Fly   210 ----ELICGHTERSPL-----SGSALTEASGTPRQFHLLGIAVAGFFSSDLDHQG-YLNIRPHLD 264

  Fly   311 WIKQQLAK 318
            ||.:..:|
  Fly   265 WISKNSSK 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 65/263 (25%)
Tryp_SPc 73..312 CDD:214473 63/260 (24%)
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 44/146 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.