DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and spirit

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster


Alignment Length:338 Identity:100/338 - (29%)
Similarity:153/338 - (45%) Gaps:78/338 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QDSDIARTCTAYKR--------SVWEETSE---------FSFLI----ENAPIIYKT-------L 63
            |..|:|||....:|        :.|.|..|         |...:    ..|||:.::       |
  Fly    52 QLEDVARTKGTCRRMEDCPSALNGWLERRESPKTCYFVRFDHYVCCAPAVAPIVTRSSQQACNEL 116

  Fly    64 DKCTSYAPL------IIGGGPAVPKEFPHAARLGHKDE-NGEVEWFCGGTLISDRHVLTAAHC-- 119
            :|.:....:      ::||.|..|:|||..|.||.:.. :..:.:.|||.||::..|||||||  
  Fly   117 NKVSKVKEIDEFFVSVVGGMPTRPREFPFMAALGWRSNFDQRIYYRCGGALIANNFVLTAAHCAD 181

  Fly   120 -HYSPQGSVNIARLGDLEFDTNNDDADPEDFDVKDFTAHPEFSYPAIYNDISVVRL---SRPVTF 180
             ...|...|.:.  ||     |....:.||..::....||::|....||||:::.|   ::|   
  Fly   182 LGGEPPSQVRLG--GD-----NLTLTEGEDISIRRVIIHPDYSASTAYNDIALLELETAAKP--- 236

  Fly   181 NDYKHPACLPFDDGRLGTSFIAIGWGQLEIVPRTENKKLQKVKL---------YNYGTRCRITAD 236
             :.| |.|:........|...|||:||.... ...:.:|.||.|         ::|         
  Fly   237 -ELK-PTCIWTQKEVTNTLVTAIGYGQTSFA-GLSSAQLLKVPLKSVSNEECQHHY--------- 289

  Fly   237 RNDELPEGYNATTQLCIGS-NEHKDTCNGDSGGPVLIYHMDYPCMYHVMGITSIGVACDTPDLPA 300
            :.|:|.:|. ..||:|.|. ...:|||.||||||:|   |....:.:|:||||:|..|.:.. |:
  Fly   290 QKDQLAQGV-LGTQMCAGDITGERDTCQGDSGGPLL---MQDGLLGYVVGITSLGQGCASGP-PS 349

  Fly   301 MYTRVHFYLDWIK 313
            :||||..::|||:
  Fly   350 VYTRVSSFVDWIE 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 85/258 (33%)
Tryp_SPc 73..312 CDD:214473 83/255 (33%)
spiritNP_001162707.1 CLIP 51..98 CDD:197829 10/45 (22%)
Tryp_SPc 132..364 CDD:238113 85/258 (33%)
Tryp_SPc 132..361 CDD:214473 83/255 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437671
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.