DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and Gzmk

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_058815.1 Gene:Gzmk / 29165 RGDID:68401 Length:258 Species:Rattus norvegicus


Alignment Length:295 Identity:83/295 - (28%)
Similarity:122/295 - (41%) Gaps:69/295 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 TSEFSFLIENAPIIYKTLDKCTSYAPLIIGGGPAVPKEFPHAARLGHKDENGEVEWFCGGTLISD 110
            :|...||:..   ||.:.:   |:...||||....|...|..|.:.::.::     .|||.||..
  Rat     5 SSALVFLVAG---IYMSSE---SFHTEIIGGREVQPHSRPFMASIQYRGKH-----ICGGVLIHP 58

  Fly   111 RHVLTAAHCHYSPQGSVNIARLGDLEFDTNNDDADP--EDFDVKDFTAHPEFSYPAIYNDISVVR 173
            :.||||||| ||...|..:. ||......|    :|  :.|::|:|.  |...:.:..|||.:::
  Rat    59 QWVLTAAHC-YSRGHSPTVV-LGAHSLSKN----EPMKQTFEIKEFI--PFSGFKSGTNDIMLIK 115

  Fly   174 LSRPVTFNDYKHPACLPFDDG---RLGTSFIAIGWGQLEIVPRTENKKLQKVKL----------- 224
            |......|  ||...|.....   |.||.....|||..:....|.:..||:|.:           
  Rat   116 LRTAAELN--KHVQLLHLRSKNYIRDGTKCQVTGWGSTKPDVLTTSDTLQEVTVTIISRKRCNSQ 178

  Fly   225 --YNYGTRCRITADRNDELPEGYNATTQLCIGSNE-HKDTCNGDSGGPVL---IYHMDYPCMYHV 283
              ||:  :..||.|             .:|.|... .||:|.||||||::   ::|         
  Rat   179 SYYNH--KPVITKD-------------MICAGDRRGEKDSCKGDSGGPLICKGVFH--------- 219

  Fly   284 MGITSIGVACDTPDLPAMYTRV-HFYLDWIKQQLA 317
             .:.|.|..|...:.|.:||.: ..|..|||.:||
  Rat   220 -ALVSGGYKCGISNKPGVYTLLTKKYQTWIKSKLA 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 75/264 (28%)
Tryp_SPc 73..312 CDD:214473 72/261 (28%)
GzmkNP_058815.1 Tryp_SPc 25..248 CDD:214473 72/262 (27%)
Tryp_SPc 26..251 CDD:238113 75/264 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1144875at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.