DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and f10

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_958870.3 Gene:f10 / 282670 ZFINID:ZDB-GENE-021206-9 Length:504 Species:Danio rerio


Alignment Length:280 Identity:80/280 - (28%)
Similarity:127/280 - (45%) Gaps:41/280 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LIENAPIIYKTLDKCTSYAPLIIGGGPAVPKEFPHAARLGHKDENGEVEWFCGGTLISDRHVLTA 116
            :||..||:...   .|:....|:.|....|.:.|..|.|.:::..|    |||||::::..:|:|
Zfish   227 IIEEEPILPVV---STAGDGRIVNGVECPPGDCPWQALLINENNMG----FCGGTILTEHFILSA 284

  Fly   117 AHCHYSPQGSVNIARLGDLEFDTNNDDADPEDFDVKDFTAHPEFSYPAIYNDISVVRLSRPVTFN 181
            ||| .:...|:.:. :|  |:||...:......||.:...|..:.....:|||::::||:|:.|.
Zfish   285 AHC-MNESLSIRVV-VG--EYDTLVPEGREATHDVDEILIHKNYQPDTYHNDIALIKLSKPIKFT 345

  Fly   182 DYKHPACLP-----------FDDGRLGTSFIAIGWGQLEIVPRTENKKLQKVKLYNYGTRCRITA 235
            .|..|||||           .||| |.:.|..:..|.|      .:..|||:.: .|..|.:...
Zfish   346 KYIIPACLPEMKFAERVLMQQDDG-LVSGFGRVREGGL------SSTILQKLTV-PYVNRAKCIE 402

  Fly   236 DRNDELPEGYNATTQLCIG-SNEHKDTCNGDSGGPVLIYHMD-YPCMYHVMGITSIGVACDTPDL 298
            ..|.::     :....|.| ..|.||.|.||||||    |:. :...:.:.|:.|.|..|.....
Zfish   403 SSNFKI-----SGRMFCAGYDQEEKDACQGDSGGP----HVTRFKNTWFITGVVSWGEGCARKGK 458

  Fly   299 PAMYTRVHFYLDWIKQQLAK 318
            ..:||:|..|:.||...:.|
Zfish   459 YGVYTQVSKYIMWINNAMTK 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 74/254 (29%)
Tryp_SPc 73..312 CDD:214473 72/251 (29%)
f10NP_958870.3 GLA 19..82 CDD:214503
EGF_CA 83..119 CDD:238011
FXa_inhibition 126..161 CDD:291342
Tryp_SPc 244..472 CDD:214473 72/252 (29%)
Tryp_SPc 245..474 CDD:238113 74/253 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.