DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and CG18636

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster


Alignment Length:241 Identity:67/241 - (27%)
Similarity:99/241 - (41%) Gaps:66/241 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 GHKDENGEVEWF-----------CGGTLISDRHVLTAAHCHYSPQGSVNIARLGDLEFDTNNDDA 144
            ||..:.....|.           |||:||:|:.|||||||..:.|..|  ||||:.| .|.:::.
  Fly    48 GHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHLV--ARLGEYE-RTRSEEC 109

  Fly   145 D------PEDFDVKDFTAHPEFSYPAIYNDISVVRLSRPVTFNDYKHPACLPFD----------D 193
            .      .|:..|.....|..:......|||:::|||:.|.:.|...|.|:.:|          |
  Fly   110 TGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKID 174

  Fly   194 GRLGTSFIAIGWGQLEIVPRTENKKLQKVKLYNYGTRCRITADRNDELPE------GYN-ATTQL 251
                 ...|.|||:.::  .:::..||             |.|...:.|:      |.. |..|.
  Fly   175 -----LLTATGWGKTQM--ESDSDALQ-------------TLDIRRQPPDVCAKFIGQTIAGNQF 219

  Fly   252 CIGSNEHKDTCNGDSGGPV--LIYHMDYPCMYHVMGITSIGVACDT 295
            |.| |...:.||||||||:  :|.|.      :......:|:|..|
  Fly   220 CAG-NWDSNLCNGDSGGPLGAVITHK------NTQRFVQVGIASYT 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 67/241 (28%)
Tryp_SPc 73..312 CDD:214473 67/241 (28%)
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 67/241 (28%)
Tryp_SPc 45..278 CDD:238113 67/241 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437572
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.