DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and CG33461

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster


Alignment Length:298 Identity:86/298 - (28%)
Similarity:126/298 - (42%) Gaps:78/298 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 FLIENAPIIYKTLDKCTSYAPLIIGGGPAVPKEFPHAARLGHKDENGEVEWFCGGTLISDRHVLT 115
            ||.||..::.:     .||.  ||.|.||....:|..|.|     :....:.|.|:||:...|||
  Fly    27 FLEENCGVVPR-----LSYK--IINGTPARLGRYPWMAFL-----HTPTYFLCAGSLINQWFVLT 79

  Fly   116 AAHCHYSPQGSVN-IARLGDLEFDTNNDDADPED--------------------FDVKDFTAHPE 159
            :|||   .:..|. |||||:   :..::|.|.|:                    :|.|||:    
  Fly    80 SAHC---IEDDVELIARLGE---NNRDNDIDCENNRCLEATQEYNVDMLFKHRLYDPKDFS---- 134

  Fly   160 FSYPAIYNDISVVRLSRPVTFNDYKHPACLPFDDGRLG------TSFIAIGWGQLEIVPRTENKK 218
                   |||.::||.|.|.:..:..|.|: |...|:.      |.|.|.|||.......|::.:
  Fly   135 -------NDIGMLRLERRVEYTYHIQPICI-FHHRRMQLVVDQITWFKATGWGLTSTDLNTKSSR 191

  Fly   219 -LQKVKLYNYGTRCRITADRND--ELPEGYNATTQLCIGSNEHKDTCNGDSGGP----VLIYHMD 276
             |.::.||.        ..|||  .:.:....:.|:|.| |:..:.|.||||||    |||:.|.
  Fly   192 VLMELNLYR--------RPRNDCARIFKQNFLSGQICAG-NDDGNLCRGDSGGPQGRYVLIFGMK 247

  Fly   277 YPCMYHVMGITSIGVACDTPDLPAMYTRVHFYLDWIKQ 314
               .:..|||.|.  ..:.....::.|.|..|..|||:
  Fly   248 ---RFVQMGIASF--TYENCSKVSILTDVVRYGRWIKK 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 80/276 (29%)
Tryp_SPc 73..312 CDD:214473 77/272 (28%)
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 77/275 (28%)
Tryp_SPc 42..281 CDD:238113 80/276 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437602
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.