DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and Sp212

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster


Alignment Length:259 Identity:72/259 - (27%)
Similarity:122/259 - (47%) Gaps:25/259 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 SYAPLIIGGGPAVPKEFPHAARLGHKDENGEVEWFCGGTLISDRHVLTAAHC-HYSPQGSVNIAR 131
            |..|.|:.|......::|..:.:.||:... :.:.|.|:|||...|::|||| |...:..| :..
  Fly   272 STTPFIVRGNEFPRGQYPWLSAVYHKEVRA-LAFKCRGSLISSSIVISAAHCVHRMTEDRV-VVG 334

  Fly   132 LGDLEFDTNNDDADPEDFDVKDFTAHPEFSYPAIYN-DISVVRLSRPVTFNDYKHPACL-PFDDG 194
            ||..:.|...:|. .|..:|.....||:::..:..: ||:::.:.|||||||...|.|: ..:..
  Fly   335 LGRYDLDDYGEDG-AEMRNVMRLLWHPDYNTRSYSDADIALITIERPVTFNDIIAPICMWTVEAS 398

  Fly   195 RL--GTSFIAIGWGQLEIVPRTENKKLQKVKLYNYGTRCRITADRNDELPEGYNATTQLCIGSNE 257
            |.  .|.||| |||:.|...||:..::.:.::.: .|.|..|. |...:.|     ..||.|:.:
  Fly   399 RTVSTTGFIA-GWGRDEDSSRTQYPRVVEAEIAS-PTVCASTW-RGTMVTE-----RSLCAGNRD 455

  Fly   258 HKDTCNGDSGGPVLIYHMDYPCMYHVMGITSIGV-----ACDTPDLPAMYTRVHFYLDWIKQQL 316
            ....|.|||||.:::...|   .:.:.||.|.|.     .|..... .:|..:..:::||.:.:
  Fly   456 GSGPCVGDSGGGLMVKQGD---RWLLRGIVSAGERGPAGTCQLNQY-VLYCDLSKHINWISENI 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 70/251 (28%)
Tryp_SPc 73..312 CDD:214473 68/248 (27%)
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 70/251 (28%)
Tryp_SPc 277..511 CDD:214473 68/248 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437653
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.