DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and Gzma

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_703198.1 Gene:Gzma / 266708 RGDID:628640 Length:261 Species:Rattus norvegicus


Alignment Length:263 Identity:79/263 - (30%)
Similarity:110/263 - (41%) Gaps:57/263 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 IIGGGPAVPKEFPHAARLGHKDENGEVEWFCGGTLISDRHVLTAAHCHYSPQGSVNIARLGDLEF 137
            ||||...||...|:...|..|.::     .|.|.||:...|||||||....:..|.:.       
  Rat    29 IIGGDTVVPHSRPYMVLLKLKPDS-----ICAGALIAKNWVLTAAHCIPGKKSEVILG------- 81

  Fly   138 DTNNDDADPED--FDVKDFTAHPEFSYPAIYNDISVVRLSRPVTFNDYKHPACLPF----DDGRL 196
             .::...:||.  ..||....:|.|.......|:.::||.:..|.|  |:.|.|..    ||.:.
  Rat    82 -AHSIKKEPEQQILSVKKAYPYPCFDKHTHEGDLQLLRLKKKATLN--KNVAILHLPKKGDDVKP 143

  Fly   197 GTSFIAIGWGQLEIVPRTENKK-----LQKVKLYNYGTRCRITADR---NDELPEGYN---ATTQ 250
            ||.....|||      |..||.     |::|.:        ...||   |||....:|   ....
  Rat   144 GTRCHVAGWG------RFHNKSPPSDTLREVNI--------TVIDRKICNDEKHYNFNPVIGLNM 194

  Fly   251 LCIGS-NEHKDTCNGDSGGPVLIYHMDYPCMYHVMGITSIGV--ACDTPDLPAMYTRV-HFYLDW 311
            :|.|: ...||:|.||||||:|       |.....|||:.|:  .|..|..|.:||.: ..:|||
  Rat   195 ICAGNLRGGKDSCYGDSGGPLL-------CEGIFRGITAFGLEGRCGDPKGPGIYTLLSDKHLDW 252

  Fly   312 IKQ 314
            |::
  Rat   253 IRK 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 79/263 (30%)
Tryp_SPc 73..312 CDD:214473 77/259 (30%)
GzmaNP_703198.1 Tryp_SPc 28..253 CDD:214473 77/259 (30%)
Tryp_SPc 29..256 CDD:238113 79/263 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.