DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and CG30091

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster


Alignment Length:264 Identity:77/264 - (29%)
Similarity:116/264 - (43%) Gaps:43/264 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 PLIIGGGPAVPKEFPHAARLGHKDENGEVEWFCGGTLISDRHVLTAAHCHYSPQGSV-----NIA 130
            |.|:||..|...:.|..|.:...|     |:.|||::|:::.|||||||..:.:..:     ...
  Fly    35 PKIVGGVDAGELKNPWMALIKTND-----EFICGGSVITNKFVLTAAHCMCTDEECIVKYTQLTV 94

  Fly   131 RLGDLEFDTNNDDADP-EDFDVKDFTAHPEFSYPAIYNDISVVRLSRPVTFNDYKHPACLPFDD- 193
            .||........:...| |.::|:....|..|:.....|||:::||.:.:.:.....|.|:..:| 
  Fly    95 TLGVYHLLATGEHNHPHEIYNVERVYIHDSFAIQNYRNDIALLRLQKSIVYKPQIKPLCILLNDQ 159

  Fly   194 ----GRLGTSFIAIGWGQLEIVPRTENKK----LQKVKLYNYGTR-CRITADRNDELPEGYNATT 249
                ..|...|.|||||.      |.|.|    ||.||:|....: |........:.|       
  Fly   160 LKPQTDLIQEFTAIGWGV------TGNGKMSNNLQMVKIYRIDRKMCEAAFWYTFDYP------- 211

  Fly   250 QLCIGSNEHKDTCNGDSGGPVLIYHMDYPCMYHV--MGITSIGVACDTPDLP--AMYTRVHFYLD 310
            ..|.|:...:|||..|||||:.| ||.:..:...  :||.|.|    |.|..  .|||.|..::|
  Fly   212 MFCAGTAVGRDTCKRDSGGPLYI-HMLFDGIKRATQLGIVSTG----TEDCRGFGMYTDVMGHID 271

  Fly   311 WIKQ 314
            :|::
  Fly   272 FIER 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 76/262 (29%)
Tryp_SPc 73..312 CDD:214473 75/258 (29%)
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 75/259 (29%)
Tryp_SPc 37..276 CDD:238113 76/262 (29%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437605
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.