DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and CG30088

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster


Alignment Length:291 Identity:98/291 - (33%)
Similarity:138/291 - (47%) Gaps:43/291 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 VWEETSEFSFLIENAPIIYKTLDKCTSYAPLIIGGGPAVPKEFPHAARLGHKDENGEVEWFCGGT 106
            |.:|....:|||.:..:.|:     ::.|..|:.|..|:.|..|..|.|.:..     |..||||
  Fly    19 VLQEQVAANFLIPSCGVSYE-----SNVATRIVRGKEAMLKSAPFMAYLYYSS-----EIHCGGT 73

  Fly   107 LISDRHVLTAAHCHYSPQGSVNIARLGDLEFDTNND----DADP--EDFDVKDFTAHPEFSYPAI 165
            :||.|::|||||| ..|...|   |||:.:...|.|    ...|  |:||:...|.:..|. ..:
  Fly    74 IISSRYILTAAHC-MRPYLKV---RLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKRFD-RFL 133

  Fly   166 YNDISVVRLSRPVTFNDYKHPACLPFDDGRLGT--SFIAIGWGQLEIVPRTENKK--LQKVKLYN 226
            .|||::::|||.:.||.:..|.||..:......  .|.|.||||.|    |.:..  ||...|..
  Fly   134 ANDIALLKLSRNIRFNVHIQPICLILNPAAAPNVHEFQAFGWGQTE----TNHSANVLQTTVLTR 194

  Fly   227 YGTR-CRITADRNDELPEGYNATTQLCIGSNEHKDTCNGDSGGPVLIYHMDYPCM--YHVMGITS 288
            |..| ||...    .:|...|   |||:|. :..|||:|||||| |:..::|..:  |..:||.|
  Fly   195 YDNRHCRSVL----SMPITIN---QLCVGF-QGSDTCSGDSGGP-LVTKVNYDGVWRYLQLGIVS 250

  Fly   289 IGVACDTPDLPAMYTRVHFYLDWIKQQLAKN 319
            .|  .|....|.:||.|..|:.||:..:..|
  Fly   251 FG--DDKCQSPGVYTYVPNYIRWIRYVMQSN 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 90/254 (35%)
Tryp_SPc 73..312 CDD:214473 88/251 (35%)
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 88/252 (35%)
Tryp_SPc 45..273 CDD:238113 89/252 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437590
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.