DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and CG30087

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:288 Identity:81/288 - (28%)
Similarity:129/288 - (44%) Gaps:63/288 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PIIYKTLDKCTSYAPLIIGGGPAVPKEFPHAA-----RLGHKDENGEVEWFCGGTLISDRHVLTA 116
            |:...|.:..|  |..::.|..||.:..|...     .|.|          |||::::.|::|||
  Fly    28 PLCGVTYESQT--AMRVVNGKEAVIRSAPFMVYVTNNSLTH----------CGGSILNSRYILTA 80

  Fly   117 AHCHYSPQGSVNI-ARLGDLEFDTNND----DADP--EDFDVKDFTAHPEFSYPAIYNDISVVRL 174
            |||.:.     |: .|||:....|:.|    :..|  |::.:.....|..::.....|||::::|
  Fly    81 AHCVFP-----NLRLRLGEHNIRTDPDCQGSNCSPRSEEYGIMKAITHRFYNAANHVNDIALLKL 140

  Fly   175 SRPVTFNDYKHPACL---PFDDGRLGTSFIAIGWGQLEIVPRTENKK------LQKVKLYNY-GT 229
            :|.:.||.:..|.|:   |.....:.| :...|||        |.||      ||..:|..| ..
  Fly   141 NRSINFNVHIQPICILLNPASAPSVAT-YQTFGWG--------ETKKNGFPHLLQTAELRAYDAA 196

  Fly   230 RCRITADRNDELPEGYNATTQLCIGSNEHKDTCNGDSGGPVLIYHMDYPCM--YHVMGITSIG-V 291
            .|..:.       ..|....|:|.| :|.:|||.|||||| |:..:|:..:  |..:||.|.| .
  Fly   197 YCSRSF-------HAYMNGNQICAG-HEERDTCAGDSGGP-LVTRVDFDGVKRYLQLGIVSYGPT 252

  Fly   292 ACDTPDLPAMYTRVHFYLDWIKQQLAKN 319
            .|.:   |.:||.|..|::||::.:..|
  Fly   253 DCQS---PGVYTYVPNYINWIRRAMLIN 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 76/266 (29%)
Tryp_SPc 73..312 CDD:214473 74/263 (28%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 74/264 (28%)
Tryp_SPc 42..272 CDD:238113 76/265 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437593
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.