DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and Prss12

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_032965.1 Gene:Prss12 / 19142 MGIID:1100881 Length:761 Species:Mus musculus


Alignment Length:258 Identity:77/258 - (29%)
Similarity:112/258 - (43%) Gaps:35/258 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 IIGGGPAVPKEFPHAARLGHKDENGEVEWFCGGTLISDRHVLTAAHC--HYSPQGSVNIARLGDL 135
            ||||..::...:|..|.|..:..:|:....||.||:|...|||||||  .|.........|:||.
Mouse   517 IIGGNNSLRGAWPWQASLRLRSAHGDGRLLCGATLLSSCWVLTAAHCFKRYGNNSRSYAVRVGDY 581

  Fly   136 EFDTNNDDADPEDFD----VKDFTAHPEFSYPAIYNDISVVRLSRP----VTFNDYKHPACLPF- 191
            .      ...||:|:    |:....|..:.......||::|||..|    ...:.:..|||||. 
Mouse   582 H------TLVPEEFEQEIGVQQIVIHRNYRPDRSDYDIALVRLQGPGEQCARLSTHVLPACLPLW 640

  Fly   192 --DDGRLGTSFIAIGWGQLEIVPRTENKKLQKVKLYNYGTR-CRITADRNDELPEGYNATTQLCI 253
              ...:..::....|||.   ..|..::.||:..:.....| |:       |..:|......||.
Mouse   641 RERPQKTASNCHITGWGD---TGRAYSRTLQQAAVPLLPKRFCK-------ERYKGLFTGRMLCA 695

  Fly   254 GS---NEHKDTCNGDSGGPVLIYHMDYPCMYHVMGITSIGVACDTPDLPAMYTRVHFYLDWIK 313
            |:   :...|:|.||||||::....|.  .:.|.|:||.|..|...|.|.:||||..::.|||
Mouse   696 GNLQEDNRVDSCQGDSGGPLMCEKPDE--SWVVYGVTSWGYGCGVKDTPGVYTRVPAFVPWIK 756

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 77/258 (30%)
Tryp_SPc 73..312 CDD:214473 74/255 (29%)
Prss12NP_032965.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 25..87
KR 83..159 CDD:214527
SR 166..265 CDD:214555
SRCR 171..265 CDD:278931
SR 273..372 CDD:214555
SRCR 278..371 CDD:278931
SR 386..485 CDD:214555
SRCR 396..485 CDD:278931
Zymogen activation region 505..516
Tryp_SPc 516..755 CDD:214473 74/255 (29%)
Tryp_SPc 517..758 CDD:238113 77/258 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4773
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.