DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and T22A3.6

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_492773.3 Gene:T22A3.6 / 188711 WormBaseID:WBGene00011909 Length:491 Species:Caenorhabditis elegans


Alignment Length:192 Identity:44/192 - (22%)
Similarity:67/192 - (34%) Gaps:58/192 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 VPKEFPHAARLGHKDENGEVEWFCGGTLISDRHVLTAAHCHYSPQGSVNIARLGDLEFDTNNDDA 144
            :|.|:.:..|  :.|:|....|...|   :|    |.|.|....:.|...:.    :|...|.|.
 Worm   138 LPDEYENFCR--NPDKNPLGPWCYVG---ND----TTAPCFQPCRPSTETSS----DFVCLNRDG 189

  Fly   145 DP-EDFDVKDFTAHPEFSYPAIYNDISVVRLSRPVTFNDYKHPACLP-FDDG--RLGT------S 199
            .| .|:|:.|....|:..  .|:.|:.::..||.|          || ..||  ||.|      .
 Worm   190 FPYTDYDMSDILDLPQLI--GIFKDVDLMYESRFV----------LPSLPDGVQRLSTKSCINKG 242

  Fly   200 FIAIGWGQ-LEIVPRTENKKLQKVKLYNYGTRCRITADRNDELPEGYNATTQLCIGS-NEHK 259
            .||..:|. :.::.:|..:.|...                     |......||..| |||:
 Worm   243 HIANHFGPWIAVLDQTATQFLAAA---------------------GRRKLRDLCFPSFNEHE 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 44/192 (23%)
Tryp_SPc 73..312 CDD:214473 44/192 (23%)
T22A3.6NP_492773.3 KR 98..173 CDD:350900 11/43 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.