DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and Plau

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_032899.1 Gene:Plau / 18792 MGIID:97611 Length:433 Species:Mus musculus


Alignment Length:272 Identity:77/272 - (28%)
Similarity:119/272 - (43%) Gaps:50/272 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 IIGGGPAVPKEFPHAARLGHKDENGEVEWF-CGGTLISDRHVLTAAHCHYS-PQGSVNIARLGDL 135
            |:||.....:..|..|.:..|::.|....| |||:|||...|.:||||... |:....:..||..
Mouse   180 IVGGEFTEVENQPWFAAIYQKNKGGSPPSFKCGGSLISPCWVASAAHCFIQLPKKENYVVYLGQS 244

  Fly   136 EFDTNNDDADPED--FDVKDFTAHPEFSYP--AIYNDISVVRL----------SRPVTFNDYKHP 186
            :..:.|    |.:  |:|:....|..:...  |.:|||:::::          ||.:      ..
Mouse   245 KESSYN----PGEMKFEVEQLILHEYYREDSLAYHNDIALLKIRTSTGQCAQPSRSI------QT 299

  Fly   187 ACLP--FDDGRLGTSFIAIGWGQLE----IVPRTENKKLQKVKLYNYGTRCRITADRNDELPEGY 245
            .|||  |.|...|:.....|:|:..    :.|:  |.|:..|||.:: .:|.        .|..|
Mouse   300 ICLPPRFTDAPFGSDCEITGFGKESESDYLYPK--NLKMSVVKLVSH-EQCM--------QPHYY 353

  Fly   246 NAT---TQLCIGSNEHK-DTCNGDSGGPVLIYHMDYPCMYHVMGITSIGVACDTPDLPAMYTRVH 306
            .:.   ..||....|.| |:|.||||||::......|.:   .||.|.|..|...:.|.:||||.
Mouse   354 GSEINYKMLCAADPEWKTDSCKGDSGGPLICNIEGRPTL---SGIVSWGRGCAEKNKPGVYTRVS 415

  Fly   307 FYLDWIKQQLAK 318
            .:||||:..:.:
Mouse   416 HFLDWIQSHIGE 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 77/267 (29%)
Tryp_SPc 73..312 CDD:214473 75/264 (28%)
PlauNP_032899.1 Binds urokinase plasminogen activator surface receptor. /evidence=ECO:0000250 35..58
Kringle 71..152 CDD:333799
Connecting peptide 153..179
Tryp_SPc 180..424 CDD:238113 77/267 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4773
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.