DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and Plat

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_032898.2 Gene:Plat / 18791 MGIID:97610 Length:559 Species:Mus musculus


Alignment Length:363 Identity:94/363 - (25%)
Similarity:142/363 - (39%) Gaps:100/363 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IVQLGAVLLVSFVAWASAQ--------------DSDIARTCTAYK--RSVWEETSEFSFLIENAP 57
            ||.:|.    |:.||.:..              |.|....|...|  :..||             
Mouse   240 IVLMGK----SYTAWRTNSQALGLGRHNYCRNPDGDARPWCHVMKDRKLTWE------------- 287

  Fly    58 IIYKTLDKCTSYA------P--LIIGGGPAVPKEFPHAARLGHKDENGEVEWF-CGGTLISDRHV 113
              |..:..|::..      |  .|.||........|..|.:..|::....|.| |||.|||...|
Mouse   288 --YCDMSPCSTCGLRQYKRPQFRIKGGLYTDITSHPWQAAIFVKNKRSPGERFLCGGVLISSCWV 350

  Fly   114 LTAAHC---HYSPQG-SVNIARL-----GDLEFDTNNDDADPEDFDVKDFTAHPEFSYPAIYNDI 169
            |:||||   .:.|.. .|.:.|.     |:.|          :.|:::.:..|.||......|||
Mouse   351 LSAAHCFLERFPPNHLKVVLGRTYRVVPGEEE----------QTFEIEKYIVHEEFDDDTYDNDI 405

  Fly   170 SVVRL----SRPVTFNDYKHPACLPFDDGRL--GTSFIAIGWGQLEIVPRTENKKLQK--VKLYN 226
            ::::|    .:....:.....||||..:.:|  .|.....|:|:.|......:.:|::  |:||.
Mouse   406 ALLQLRSQSKQCAQESSSVGTACLPDPNLQLPDWTECELSGYGKHEASSPFFSDRLKEAHVRLYP 470

  Fly   227 YGTRCRITADRNDELPEGYNAT---TQLCI------GSNEHKDTCNGDSGGPVLIYHMDYPCMYH 282
             .:||     .:..|   :|.|   ..||.      |:.:..|.|.||||||::       ||.:
Mouse   471 -SSRC-----TSQHL---FNKTVTNNMLCAGDTRSGGNQDLHDACQGDSGGPLV-------CMIN 519

  Fly   283 ----VMGITSIGVACDTPDLPAMYTRVHFYLDWIKQQL 316
                :.||.|.|:.|...|:|.:||:|..|||||...:
Mouse   520 KQMTLTGIISWGLGCGQKDVPGVYTKVTNYLDWIHDNM 557

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 79/272 (29%)
Tryp_SPc 73..312 CDD:214473 77/269 (29%)
PlatNP_032898.2 FN1 38..80 CDD:214494
Important for binding to annexin A2. /evidence=ECO:0000250 39..49
EGF 83..115 CDD:394967
Kringle 124..205 CDD:395005
KR 210..295 CDD:238056 13/73 (18%)
Tryp_SPc 311..556 CDD:238113 78/270 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4773
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.