DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and try-4

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_508030.4 Gene:try-4 / 185148 WormBaseID:WBGene00006622 Length:324 Species:Caenorhabditis elegans


Alignment Length:275 Identity:66/275 - (24%)
Similarity:104/275 - (37%) Gaps:58/275 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 KEFPHAARLGHKDENGEVEWFCGGTLISDRHVLTAAHCHYSPQGS------------VNIARLGD 134
            |.||.|........|.     .||::||..|::||||...:..||            .|.:....
 Worm    56 KNFPWAVSFTVDGVNR-----LGGSIISPYHIITAAHGFITTIGSRGNLCENKNWKKPNSSIYRS 115

  Fly   135 LEF--DT-----------NNDDADPED----------FDVKDFTAHPEFSYPAIY--NDISVVRL 174
            ::|  ||           .:.|..|.|          ..|:......||:.....  :|.::|.:
 Worm   116 IKFLRDTRKVAYGGTCIRGHTDKYPNDPRCKKSDVIHNKVRAVLVDGEFASSNCLKGHDWAIVEV 180

  Fly   175 SRPVTFNDYKHPACLPFDDGRLGTSFIAIGWGQLEIVPRTENKKLQKVKLYNYGTRCRITAD--- 236
            .:.:.|::...|.|||..:.....|....|||:..|. ......:.::.:       ||..|   
 Worm   181 EKRIHFSENVRPICLPRPNMYYTKSLAVPGWGRSYIF-NESGPLIHEIPM-------RIDRDCKR 237

  Fly   237 -RNDELP---EGYNATTQLCIGSNEHKDTCNGDSGGPVLIYHMDYPCMYHVMGITSIGVACDTPD 297
             .:|.||   :.:...|.:.:.:.....||:|||||. |.|..|......::.|||.|......:
 Worm   238 PWSDRLPADADDFICATSMNVSNYSAPRTCHGDSGGG-LEYRDDNYGRAFLIAITSFGTRGCPSN 301

  Fly   298 LPAMYTRVHFYLDWI 312
            :.|.:|||..||:.|
 Worm   302 MLARFTRVDMYLNLI 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 66/275 (24%)
Tryp_SPc 73..312 CDD:214473 65/273 (24%)
try-4NP_508030.4 Tryp_SPc 51..318 CDD:238113 66/275 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.