DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and svh-1

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_501379.2 Gene:svh-1 / 182375 WormBaseID:WBGene00006620 Length:951 Species:Caenorhabditis elegans


Alignment Length:266 Identity:73/266 - (27%)
Similarity:117/266 - (43%) Gaps:44/266 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 DKCTSYAPLIIGGGPAVPKEFPHAARLGHKDENGEVEWFCGGTLISDRHVLTAAHCHYSPQ--GS 126
            |...|....::||...||..||..|.|.:|.....   .||.:::...|::|||||....:  .|
 Worm   704 DAAKSRIARVVGGFETVPGAFPWTAALRNKATKAH---HCGASILDKTHLITAAHCFEEDERVSS 765

  Fly   127 VNIARLGDLEFDTNNDDADPEDFDVKDFTAHPEFSYPAIY-NDISVVRLSRP-VTFNDYKHPACL 189
            ..:. :||  :|.|..|.:.:.|.::....:|  .|..|: :||:::.:..| :.||:|..|.||
 Worm   766 YEVV-VGD--WDNNQTDGNEQIFYLQRIHFYP--LYKDIFSHDIAILEIPYPGIEFNEYAQPICL 825

  Fly   190 PFDD-----GRLGTSFIAIGWGQLEIVPRTENKKLQKVKLYNYGTRCRITADRNDELPEGYNATT 249
            |..|     ||   ..:..|||.:.: ...|..:...:.:.|     |.....:.::   |::.:
 Worm   826 PSKDFVYTPGR---QCVVSGWGSMGL-RYAERLQAALIPIIN-----RFDCVNSSQI---YSSMS 878

  Fly   250 Q--LCIGSNEHK-DTCNGDSGGPVLIYHMDYPC-----MYHVMGITSIGVACDTPDLPAMYTRVH 306
            :  .|.|..|.. |:|.||||||       :.|     .:.:.|:.|.|..|.....|.:||.|.
 Worm   879 RSAFCAGYLEGGIDSCQGDSGGP-------FACRREDGAFVLAGVISWGDGCAQKKQPGIYTMVA 936

  Fly   307 FYLDWI 312
            .||.||
 Worm   937 PYLSWI 942

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 71/257 (28%)
Tryp_SPc 73..312 CDD:214473 69/255 (27%)
svh-1NP_501379.2 KR 227..306 CDD:214527
LDLa 320..355 CDD:238060
PAN_AP_HGF 373..434 CDD:238532
LDLa 558..590 CDD:197566
SRCR_2 599..681 CDD:382996
Tryp_SPc 713..945 CDD:238113 71/257 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.