DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and Gzmk

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_032222.1 Gene:Gzmk / 14945 MGIID:1298232 Length:263 Species:Mus musculus


Alignment Length:269 Identity:73/269 - (27%)
Similarity:109/269 - (40%) Gaps:60/269 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 IIGGGPAVPKEFPHAARLGHKDENGEVEWFCGGTLISDRHVLTAAHCH-YSPQGSVNIARLGDLE 136
            ||||....|...|..|.:.::.::     .|||.||..:.|||||||: :.|:|......||...
Mouse    26 IIGGREVQPHSRPFMASIQYRSKH-----ICGGVLIHPQWVLTAAHCYSWFPRGHSPTVVLGAHS 85

  Fly   137 FDTNNDDADP--EDFDVKDFTAHPEFSYPAIYNDISVVRLSRPVTFNDYKHPACLPFDDG---RL 196
            ...|    :|  :.|::|.|.........:..:||.:::|......|  |:...|.....   |.
Mouse    86 LSKN----EPMKQTFEIKKFIPFSRLQSGSASHDIMLIKLRTAAELN--KNVQLLHLGSKNYLRD 144

  Fly   197 GTSFIAIGWGQLEIVPRTENKKLQKVKL-------------YNYGTRCRITADRNDELPEGYNAT 248
            ||.....|||..:....|.:..|::|.:             ||:  :..||.|            
Mouse   145 GTKCQVTGWGTTKPDLLTASDTLREVTVTIISRKRCNSQSYYNH--KPVITKD------------ 195

  Fly   249 TQLCIG-SNEHKDTCNGDSGGPVL---IYHMDYPCMYHVMGITSIGVACDTPDLPAMYTRV-HFY 308
             .:|.| :...||:|.||||||::   |:|          .:.|.|..|.....|.:||.: ..|
Mouse   196 -MICAGDARGQKDSCKGDSGGPLICKGIFH----------ALVSQGYKCGIAKKPGIYTLLTKKY 249

  Fly   309 LDWIKQQLA 317
            ..|||.:||
Mouse   250 QTWIKSKLA 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 71/265 (27%)
Tryp_SPc 73..312 CDD:214473 68/262 (26%)
GzmkNP_032222.1 Tryp_SPc 25..253 CDD:214473 68/262 (26%)
Tryp_SPc 26..256 CDD:238113 71/265 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.