DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and CG43742

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:297 Identity:86/297 - (28%)
Similarity:119/297 - (40%) Gaps:81/297 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 FSFLIENAPIIYKTLDKCTSYAPL------------IIGGGPAVPKEFPHAARLGHKDENGEVEW 101
            ||.|:. |.:||:     .::|.|            :..|..|:..:|..|.       ....|:
  Fly     5 FSLLLV-AVVIYQ-----NAFAQLLDENCKVKITYRVANGHTAITSQFMAAL-------YNNSEF 56

  Fly   102 FCGGTLISDRHVLTAAHCHYSPQGSVNIARLGDLEFDT-----NNDDAD-PEDFDVKDFTA---- 156
            ||||:||..::|||||||            :.||:..|     ||.... |....|....|    
  Fly    57 FCGGSLIHKQYVLTAAHC------------VRDLDEVTVHLGENNRSCPIPVCKHVLRLNAKVIL 109

  Fly   157 HPEFSYPAIYNDISVVRLSRPVTFNDYKHPACLPFDD---GRLGTSFIAIGWGQLEIVPRTENKK 218
            ||.|......|||:::||.|.|.|..:..|.|:..|:   .....:|.|.|||      :||:..
  Fly   110 HPNFHGNIFLNDIALLRLEREVIFEAHIRPICIILDEDVTSNNQNNFTAYGWG------KTEHGN 168

  Fly   219 LQKVKLYNYGTRCRITADRNDELPEG--YNATTQLCIGSNEHKDTCNGDSGGPVL--IYH----M 275
            :..|..:....|          ||:.  |.....:|.||.. .|||..|||||::  ..|    .
  Fly   169 ISDVLSFIDLVR----------LPKSMCYQNINTICAGSTS-GDTCESDSGGPLIGNFVHRGKSR 222

  Fly   276 DYPCMYHVMGITSIGVACDTPDLPAMYTRVHFYLDWI 312
            |.     :.||||.|.| :...|..:||.|:.|..||
  Fly   223 DI-----LFGITSYGDA-ECSGLFGVYTDVNAYKSWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 78/261 (30%)
Tryp_SPc 73..312 CDD:214473 76/259 (29%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 76/260 (29%)
Tryp_SPc 35..256 CDD:238113 78/261 (30%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437608
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.